FANDOM


Parts of the TniQ protein appear in Foldit the CRISPR-Cas Transposase series of puzzles.

Puzzle 1784 first presented the sequence shown below, which is roughly the first half of TniQ. (See TniQ part 2 for the longer second half, with 202 segments.)

Primary sequence in FolditEdit

The sequence has a length of 188 residues (segments).

The overall Foldit sequence is:

mflqrpkpysdeslesffirvankngygdvhrfleatkrflqdidhngyqtfptditrinpysaknsssartasflklaqltfneppellglainrtnmkyspstsavvrgaevfprsllrthsipccplclrengyasylwhfqgyeychshnvplittcscgkefdyrvsglkgicckckepitlt

With rulers, the sequence is:

         1         2         3         4         5         6         7         8
12345678901234567890123456789012345678901234567890123456789012345678901234567890
mflqrpkpysdeslesffirvankngygdvhrfleatkrflqdidhngyqtfptditrinpysaknsssartasflklaq

                   1         1         1         1         1         1         1
8        9         0         1         2         3         4         5         6
12345678901234567890123456789012345678901234567890123456789012345678901234567890
ltfneppellglainrtnmkyspstsavvrgaevfprsllrthsipccplclrengyasylwhfqgyeychshnvplitt

1        1         1       1
6        7         8       8
1234567890123456789012345678
cscgkefdyrvsglkgicckckepitlt

PDB MatchesEdit

As described in CRISPR-Cas Transposase, the sequence matches chains I and J of these three PDB entries:

In these three PDB entries chain I is referred to as "TniQ monomer 1", and chain J is "TniQ monomer 2". The two chains start out with identical sequences, but then diverge.

While the two chains have different primary sequences, the sequence of each chain I is identical in all three PDB entries, and each chain J is also identical to the other chains J.

Chains I and J together form a dimer that makes the complete TniQ.

The identical chains in the three PDB entries mean matches to Foldit are also identical.

(The 3D structure (tertiary structure of the TniQ protein is likely to be at least somewhat different between 6PIF, 6PIG, and 6PIJ.)

The online tool JPred can be used to match a primary structure to the PDB.

Combining three reports, the JPred results for chain I of the three PDB entries is:

>6pif_I, 6pig_I, 6pij_I mol:protein length:358  TniQ monomer I
          Length = 358

 Score =  340 bits (871), Expect = 3e-93
 Identities = 162/162 (100%), Positives = 162/162 (100%)

Query: 1   MFLQRPKPYSDESLESFFIRVANKNGYGDVHRFLEATKRFLQDIDHNGYQTFPTDITRIN 60
           MFLQRPKPYSDESLESFFIRVANKNGYGDVHRFLEATKRFLQDIDHNGYQTFPTDITRIN
Sbjct: 2   MFLQRPKPYSDESLESFFIRVANKNGYGDVHRFLEATKRFLQDIDHNGYQTFPTDITRIN 61

Query: 61  PYSAKNSSSARTASFLKLAQLTFNEPPELLGLAINRTNMKYSPSTSAVVRGAEVFPRSLL 120
           PYSAKNSSSARTASFLKLAQLTFNEPPELLGLAINRTNMKYSPSTSAVVRGAEVFPRSLL
Sbjct: 62  PYSAKNSSSARTASFLKLAQLTFNEPPELLGLAINRTNMKYSPSTSAVVRGAEVFPRSLL 121

Query: 121 RTHSIPCCPLCLRENGYASYLWHFQGYEYCHSHNVPLITTCS 162
           RTHSIPCCPLCLRENGYASYLWHFQGYEYCHSHNVPLITTCS
Sbjct: 122 RTHSIPCCPLCLRENGYASYLWHFQGYEYCHSHNVPLITTCS 163

Combining the matches for chain J shows:

>6pif_J, 6pig_J, 6pij_J mol:protein length:369  TniQ monomer 2
          Length = 369

 Score =  362 bits (928), Expect = e-100
 Identities = 172/172 (100%), Positives = 172/172 (100%)

Query: 1   MFLQRPKPYSDESLESFFIRVANKNGYGDVHRFLEATKRFLQDIDHNGYQTFPTDITRIN 60
           MFLQRPKPYSDESLESFFIRVANKNGYGDVHRFLEATKRFLQDIDHNGYQTFPTDITRIN
Sbjct: 2   MFLQRPKPYSDESLESFFIRVANKNGYGDVHRFLEATKRFLQDIDHNGYQTFPTDITRIN 61

Query: 61  PYSAKNSSSARTASFLKLAQLTFNEPPELLGLAINRTNMKYSPSTSAVVRGAEVFPRSLL 120
           PYSAKNSSSARTASFLKLAQLTFNEPPELLGLAINRTNMKYSPSTSAVVRGAEVFPRSLL
Sbjct: 62  PYSAKNSSSARTASFLKLAQLTFNEPPELLGLAINRTNMKYSPSTSAVVRGAEVFPRSLL 121

Query: 121 RTHSIPCCPLCLRENGYASYLWHFQGYEYCHSHNVPLITTCSCGKEFDYRVS 172
           RTHSIPCCPLCLRENGYASYLWHFQGYEYCHSHNVPLITTCSCGKEFDYRVS
Sbjct: 122 RTHSIPCCPLCLRENGYASYLWHFQGYEYCHSHNVPLITTCSCGKEFDYRVS 173

Both chains I and J match the Foldit protein starting with first segment. The match starts with the second residue of the PDB sequence. (The first PDB residue, alanine, doesn't seem to have been captured in the actual experiment.)

Neither chain I or chain J match the complete Foldit protein. Chain I matches only the first 121 Foldit segments, while chain J matches 173 out of the the 188 Foldit segments. The missing Foldit segments don't seem to occur anywhere in the sequences from the PDB entries.

Community content is available under CC-BY-SA unless otherwise noted.