FANDOM


Irc 434770 1470258260 S1 KarenCH

KarenCH's spinach protein from puzzle 1264.

Spinach Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 63: Spinach Protein.

As the name suggests, this protein is from spinach, Spinacia oleracea to be specific. It's an example of a ferredoxin, a type of iron–sulfur protein that can change the oxidation state of iron.

The puzzle has 97 segments with the sequence:

 aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqddqsfldddqidegwvltcaaypvsdvtiethkkeelta

This sequence is found in the Protein Data Bank as 1A70. (The sequence is at offset 0 of chain A in 1A70.)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle: