FANDOM


Irc 308854 1393455666 S1 Timo van der Laan

Timo van der Laan's NK-lysin from puzzle 848.

Pig is a revisiting puzzle, originally presented as Puzzle 97: Pig in 2008.

The protein in this puzzle is a saposin, a family of proteins found in the lysosomes of plants and animals. This particular protein is identified as NK-lysin or NKL, and is found in a member of the pig family, the wild boar Sus scrofa. NKL shows high anti-bacterial activity against common bacteria such as E. coli.

The puzzle protein has 78 segments with the sequence:

gyfcescrkiiqkledmvgpqpnedtvtqaasqvcdklkilrglckkimrsflrriswdiltgkkpqaicvdikicke

This sequence is found in this Protein Data Bank entry:

  • 1NKL (chain A, offset 0)

The puzzle protein can have three disulfide bridges, identified in 1NKL as 4-76, 7-70, and 35-45. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

4,76 7,70 35,45

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle: