Paul Dunn's PDZ Domain from puzzle 882.
PDZ Domain is a revisiting puzzle, originally presented as Puzzle 124: PDZ Domain Protein in 2009.
The protein in this puzzle is an example of a PDZ domain, a common component of many larger proteins. There are about 260 PDZ domains in humans, found in about 180 unique proteins. (Some proteins have more than one PDZ domain.)
PDZ domains bind to other proteins and help to organize signalling complexes at cellular membranes.
The protein in this puzzle appears part of the human PICK1 protein, although it's not an exact match to any PDB entries, as described in detail below.
The puzzle protein has 91 segments with the sequence:
smvpgkvtlqkdaqnligisigggaqpclyivqvfdntpaaldgtvaagdeitgvngrsikgktkvevakmiqevkgevtihynklqyykv
A partial match for his sequence is found in this Protein Data Bank entry:
- 2GZV (chain A, offset 21)
The matching sequence in 2GZV has two segments not found in the Foldit protein. The extra tyrosine and cysteine are shown as YC in this sequence:
smvpgkvtlqkdaqnligisigggaqYCpclyivqvfdntpaaldgtvaagdeitgvngrsikgktkvevakmiqevkgevtihynklqyykv
PDB 2GZV is the closest match to the puzzle protein, but other PDB entries such as 2LUI, 2PKU, 6AR4, 6BJO, and 6BJN are similar, matching fewer segments of the puzzle protein. All of these partial matches contain the extra YC segments, and all are identified as being part of PICK1.
The puzzle protein does not form disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 124: PDZ Domain Protein | 02/06/09 | 10,139 | monteecristo | 10,178 | Madde | 10,178 | Void Crushers | |
| 882: Revisiting Puzzle 124: PDZ Domain | 05/01/14 | 9,289 | pauldunn | 9,329 | gloverd | 9,329 | Go Science | |
| 1176: Revisiting Puzzle 124: PDZ Domain | 01/06/16 | 9,447 | mimi | 9,453 | gitwut | 9,453 | Contenders | |
| 1397: Revisiting Puzzle 124: PDZ Domain | 07/06/17 | 9,461 | eusair | 9,469 | LociOiling | 9,469 | Beta Folders | |
| 1660: Revisiting Puzzle 124: PDZ Domain | 04/16/19 | 10,984 | robgee | 11,000 | Galaxie | 11,000 | Galaxie | |
| 1842: Revisiting Puzzle 124: PDZ Domain | 05/29/20 | 10,977 | Bruno Kestemont | 10,976 | Galaxie | 10,977 | Go Science | |
| 2119: Revisiting Puzzle 124: PDZ Domain | 03/17/22 | 11,063 | NinjaGreg | 11,089 | Bruno Kestemont | 11,089 | Go Science | |
| 2387: Revisiting Puzzle 124: PDZ Domain | 12/13/23 | 11,071 | LociOiling | 11,069 | LociOiling | 11,071 | Anthropic Dreams | Hat trick, Loci! |