FANDOM


Irc 447652 1375394677 E3 Beta folders Bruno kestemont

Bruno Kestemont's integrase from puzzle 751.

Integrase is a revisiting puzzle, originally presented in 2008 as Puzzle 67: Integrase.

Integrase is an enzyme used by retroviruses to insert their DNA into the DNA of another organism.

The puzzle has 71 segments with the sequence:

ekrrdnrgrilktgesqrkdgrylykyidsfgepqfvyswklvatdrvpagkrdcislrekiaelqkdihd

This sequence is found in two Protein Data Bank entries:

  • 1BB8 (chain A, offset 0)
  • 2BB8 (chain A, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

eral Protein Data Bank entries:

  • 1BB8 (chain A, offset 0)
  • 2BB8 (chain A, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle: