FANDOM


Irc 455069 1389233494 S1 retiredmichael

retiredmichael's heliomicin from Puzzle 829.

Heliomicin is a Foldit revisiting puzzle, originally presented as Puzzle 90: Heliomicin in 2008.

Heliomicin is an anti-fungal protein produced by the moth Heliothis virescens, commonly known as the tobacco budworm. Heliomicin is a type of defensin, proteins which guard against fungi, bacteria, and viruses.

The puzzle protein has 44 segments with the sequence:

dkligscvwgavnytsdcngeckrrgykgghcgsfanvncwcet

The sequence is found in this Protein Data Bank entry:

  • 1I2U (chain A, offset 0)

The puzzle protein can have three disulfide bridges, identified in 1I2U as 7-32, 18-40, and 22-42. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

7,32 18,40 22,42

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.