FANDOM


Irc 455069 1392256597 S1 retiredmichael

retiredmichael's collagen component from puzzle 842.

Collagen is a revisiting puzzle, originally presented as Puzzle 96: Collagen in 2008.

As the name implies, the protein in this puzzle is a component of collagen, a protein found in connective tissue. The puzzle protein is not a complete collagen, but the "Kunitz-type domain from the alpha3 chain of human type VI collagen".

The puzzle protein has 55 segments with the sequence:

tdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvca

This sequence is found in this Protein Data Bank entry:

  • 2KNT (chain A, offset 1)
  • 1KUN (chain A, offset 1)
  • 1KTH (chain A, offset 1)
  • 1KNT (chain A, offset 1)

The puzzle protein can have three disulfide bridges, identified in 2KNT as 5-55, 14-38, and 30-51. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points. Since the matching PDB entries start with an additional residue, subtract one to get the Foldit segment number.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

4,54 13,37 29,50

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle: