FANDOM


Irc 732310 1503008872 G2 Gargleblasters E1 actiasluna 9561

actiasluna's echistatin from puzzle 1415.

Cell adhesion is a revisiting puzzle, originally presented as Puzzle 136: Cell Adhesion in 2009.

(See Cell Adhesion Protein for the similarly-named revisiting series based on Puzzle 85.)

Keeping with theme of toxins found in revisiting puzzles, the puzzle protein is a disintegrin, one of a family of proteins found in viper venoms. As the name "disintegrin" suggests, this protein actually works against cell adhesion, specifically inhibiting blood clotting.

This particular disintegrin is known as an echistatin, based on genus of the source viper, Echis carinatus sochureki, or Sochurek's saw-scaled viper.

The puzzle protein has 49 segments with the sequence:

ecesgpccrnckflkegtickrargddmddycngktcdcprnphkgpat

This sequence is found in these Protein Data Bank entries:

  • 1RO3 (chain A, offset 0)
  • 2ECH (chain A, offset 0)

The puzzle protein can have four disulfide bridges, identified in 1RO3 and 2ECH as 2-11, 7-32, 8-37, and 20-39. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

2,11 7,32 8,37 20,39 

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle: