FANDOM


Irc 434770 1429358270 S2 KarenCH

KarenCH's calbindin from puzzle 1047.

Bos taurus is a revisiting puzzle, originally presented in 2008 as Puzzle 68: Bos taurus.

Bos taurus is Latin for "cow". The protein in this puzzle comes from cows. It's a type of calbindin, a calcium-binding protein.

The puzzle has 75 segments with the sequence:

kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdgevsfeefqvlvkkisq

This sequence is found in the following Protein Data Bank entries:

  • 1BLG (chain A, offset 0)
  • 1CDN (chain A, offset 1)
  • 1CLB (chain A, offset 1)
  • 2BCA (chain A, offset 1)
  • 2BCB (chain A, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.