Foldit Wiki
Advertisement

Timo van der Laan's NK-lysin from puzzle 848.

97: Pig is a revisiting puzzle, originally presented as Puzzle 97: Pig in 2008.

The protein in this puzzle is a saposin, a family of proteins found in the lysosomes of plants and animals. This particular protein is identified as NK-lysin or NKL, and is found in a member of the pig family, the wild boar Sus scrofa. NKL shows high anti-bacterial activity against common bacteria such as E. coli.

The puzzle protein has 78 segments with the sequence:

gyfcescrkiiqkledmvgpqpnedtvtqaasqvcdklkilrglckkimrsflrriswdiltgkkpqaicvdikicke

This sequence is found in this Protein Data Bank entry:

  • 1NKL (chain A, offset 0)

The puzzle protein can have three disulfide bridges, identified in 1NKL as 4-76, 7-70, and 35-45. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

4,76 7,70 35,45

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
97: Pig 10/22/08 9,652 labraticmp3 9,613 g_s 9,617 Another Hour Another Point
848: Revisiting Puzzle 97: Pig 02/26/14 9,680 Timo van der Laan 9,659 spdenne 9,680 Void Crushers
1153: Revisiting Puzzle 97: Pig 11/04/15 9,864 LociOiling 9,902 Galaxie 9,902 Anthropic Dreams
1371: Revisiting Puzzle 97: Pig 05/04/17 9,998 fiendish_ghoul 9,997 smilingone 9,997 Beta Folders
1633: Revisiting Puzzle 97: Pig 02/13/19 11,070 Aubade01 11,074 smilingone 11,074 Beta Folders
1813: Revisiting Puzzle 97: Pig 03/25/20 11,074 grogar7 11,066 Galaxie 11,074 Anthropic Dreams
2092: Revisiting Puzzle 97: Pig 01/13/22 11,187 NinjaGreg 11,199 Bruno Kestemont 11,199 Go Science
Advertisement