Timo van der Laan's NK-lysin from puzzle 848.
97: Pig is a revisiting puzzle, originally presented as Puzzle 97: Pig in 2008.
The protein in this puzzle is a saposin, a family of proteins found in the lysosomes of plants and animals. This particular protein is identified as NK-lysin or NKL, and is found in a member of the pig family, the wild boar Sus scrofa. NKL shows high anti-bacterial activity against common bacteria such as E. coli.
The puzzle protein has 78 segments with the sequence:
gyfcescrkiiqkledmvgpqpnedtvtqaasqvcdklkilrglckkimrsflrriswdiltgkkpqaicvdikicke
This sequence is found in this Protein Data Bank entry:
- 1NKL (chain A, offset 0)
The puzzle protein can have three disulfide bridges, identified in 1NKL as 4-76, 7-70, and 35-45. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
4,76 7,70 35,45
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 97: Pig | 10/22/08 | 9,652 | labraticmp3 | 9,613 | g_s | 9,617 | Another Hour Another Point | |
| 848: Revisiting Puzzle 97: Pig | 02/26/14 | 9,680 | Timo van der Laan | 9,659 | spdenne | 9,680 | Void Crushers | |
| 1153: Revisiting Puzzle 97: Pig | 11/04/15 | 9,864 | LociOiling | 9,902 | Galaxie | 9,902 | Anthropic Dreams | |
| 1371: Revisiting Puzzle 97: Pig | 05/04/17 | 9,998 | fiendish_ghoul | 9,997 | smilingone | 9,997 | Beta Folders | |
| 1633: Revisiting Puzzle 97: Pig | 02/13/19 | 11,070 | Aubade01 | 11,074 | smilingone | 11,074 | Beta Folders | |
| 1813: Revisiting Puzzle 97: Pig | 03/25/20 | 11,074 | grogar7 | 11,066 | Galaxie | 11,074 | Anthropic Dreams | |
| 2092: Revisiting Puzzle 97: Pig | 01/13/22 | 11,187 | NinjaGreg | 11,199 | Bruno Kestemont | 11,199 | Go Science |
