FANDOM


Irc 455069 1392256597 S1 retiredmichael

retiredmichael's collagen component from puzzle 842.

96: Collagen is a revisiting puzzle, originally presented as Puzzle 96: Collagen in 2008.

As the name implies, the protein in this puzzle is a component of collagen, a protein found in connective tissue. The puzzle protein is not a complete collagen, but the "Kunitz-type domain from the alpha3 chain of human type VI collagen".

The puzzle protein has 55 segments with the sequence:

tdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvca

This sequence is found in this Protein Data Bank entry:

  • 2KNT (chain A, offset 1)
  • 1KUN (chain A, offset 1)
  • 1KTH (chain A, offset 1)
  • 1KNT (chain A, offset 1)

The puzzle protein can have three disulfide bridges, identified in 2KNT as 5-55, 14-38, and 30-51. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points. Since the matching PDB entries start with an additional residue, subtract one to get the Foldit segment number.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

4,54 13,37 29,50

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
96: Collagen 10/20/08 9,072 Steven Pletsch 9,133 g_s 9,133 Another Hour Another Point
842: Revisiting Puzzle 96: Collagen 02/12/14 8,950 retiredmichael 8,958 dembones 8,958 Contenders
1151: Revisiting Puzzle 96: Collagen 10/28/15 9,384 gitwut 9,384 gitwut 9,384 Contenders
1368: Revisiting Puzzle 96: Collagen 04/27/17 9,557 Timo van der Laan 9,546 kabubi 9,557 Void Crushers
1630: Revisiting Puzzle 96: Collagen 02/06/19 10,226 Aubade01 10,210 Galaxie 10,210 Anthropic Dreams
1810: Revisiting Puzzle 96: Collagen 03/18/20 10,222 Serca 10,186 fpc 10,222 Go Science
Community content is available under CC-BY-SA unless otherwise noted.