FANDOM


Irc 502210 1445425922 S2 Skippysk8s

Skippysk8s' chicken troponin C from puzzle 1149.

95: Chicken is a revisiting puzzle, originally presented as Puzzle 95: Chicken in 2008.

The puzzle protein is part of troponin, a complex of three proteins. This particular protein is known as troponin C, and is a component of the troponin found in the heart muscle of ordinary chickens, Gallus gallus. Along with the other components, troponin I and troponin T, troponin is responsible for the contraction of cardiac and skeletal muscle.

The puzzle protein has 81 segments with the sequence:

mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdgdknndgridydeflefmkgve

This sequence is found in this Protein Data Bank entry:

  • 1SCV (chain A, offset 0)
  • 1SBJ (chain A, offset 0)
  • 1LA0 (chain A, offset 0)
  • 1FI5 (chain A, offset 0)

The puzzle protein does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
95: Chicken 10/17/08 9,932 diGriz 9,932 g_s 9,932 Another Hour Another Point
839: Revisited Puzzle 95: Chicken 02/05/14 9,540 dpmattingly 9,561 smilingone 9,561 Beta Folders
1149: Revisiting Puzzle 95: Chicken 10/21/15 9,323 egran48 9,328 gloverd 9,328 Go Science
1365: Revisiting Puzzle 95: Chicken 04/20/17 9,488 gitwut 9,482 Bletchley Park 9,488 Contenders
1627: Revisiting Puzzle 95: Chicken 01/30/19 10,854 tyler0911 10,897 Galaxie 10,897 Antropic Dreams
1807: Revisiting Puzzle 95: Chicken 03/11/20 10,830 LociOiling 10,826 LociOiling 10,830 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.