FANDOM


Irc 447652 1444840025 G1 Go Science E1 Bruno Kestemont

Bruno Kestemont's mouse chemokine from puzzle 1146.

94: Mouse is a revisiting puzzle, originally presented as Puzzle 94: Mouse in 2008.

The protein in this puzzle is a component of the immune system in ordinary mice, Mus musculus. The protein, a chemokine known as CCL20/MIP-3alpha, or simply CCL20, is also found in humans. CCL20 may play a role in autoimmune diseases such as multiple sclerosis.

The puzzle protein has 70 segments with the sequence:

asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm 

This sequence is found in this Protein Data Bank entry:

  • 1HA6 (chain A, offset 0)

The puzzle protein can have two disulfide bridges, identified in 1HA6 as 6-32, and 7-48. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

6,32 7,48 

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
94: Mouse 10/15/08 9,410 g_s 9,419 sirenbrian 9,419 Another Hour Another Point
836: Revisiting Puzzle 94: Mouse 01/27/14 9,612 frood66 9,622 ManVsYard 9,622 Gargleblasters
1146: Revisiting Puzzle 94: Mouse 10/14/15 9,152 hpaege 9,196 Bruno Kestemont 9,196 Go Science
1362: Revisiting Puzzle 94: Mouse 04/13/17 9,529 bertro 9,531 smilingone 9,531 Beta Folders
1624: Revisiting Puzzle 94: Mouse 01/23/19 10,616 tyler0911 10,616 Galaxie 10,616 Anthropic Dreams
1804: Revisiting Puzzle 94: Mouse 03/04/20 10,482 ZeroLeak7 10,484 mirp 10,484 Go Science
Community content is available under CC-BY-SA unless otherwise noted.