toshiue's spider toxin from puzzle 1359.
93: Spider Toxin is a revisiting puzzle, originally presented as Puzzle 93: Spider Toxin in 2008.
The toxin in this puzzle is from Agelenopsis aperta, known as the desert grass spider. This spider is native to the southwestern United States and Mexico, and seems relatively innocuous as compared to the cobras and scorpions that inhabit other revisiting puzzles.
The puzzle protein has 48 segments with the sequence:
kkkciakdygrckwggtpccrgrgcicsimgtnceckprlimeglgla
This sequence is found in these Protein Data Bank entries:
The puzzle protein can have four disulfide bridges, identified in 1IVA as 4-20, 12-25, 19-36, and 27-34. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
4,20 12,25 19,36 27,34
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 93: Spider Toxin | 10/13/08 | 8,649 | MellyLam | 8,574 | Aotearoa | 8,649 | Another Hour Another Point | |
| 834: Revisiting Puzzle 93: Spider Toxin | 01/22/14 | 8,882 | gloverd | 8,905 | MaartenDesnouck | 8,905 | Anthropic Dreams | |
| 1143: Revisiting Puzzle 93: Spider Toxin | 10/07/15 | 9,350 | mirp | 9,355 | Paulo Roque | 9,355 | Go Science | |
| 1359: Revisiting Puzzle 93: Spider Toxin | 04/06/17 | 9,541 | Z7ro | 9,542 | toshiue | 9,542 | Go Science | |
| 1620: Revisiting Puzzle 93: Spider Toxin | 01/16/19 | 9,996 | dcrwheeler | 9,883 | Bruno Kestemont | 9,910 | Void Crushers | |
| 1801: Revisiting Puzzle 93: Spider Toxin | 02/18/20 | 10,101 | crpainter | 9,945 | ZeroLeak7 | 9,945 | Go Science | |
| 2080: Revisiting Puzzle 93: Spider Toxin | 12/16/21 | 9,963 | LociOiling | 9,962 | LociOiling | 9,963 | Beta Folders | Hat trick! |
| 2346: Revisiting Puzzle 93: Spider Toxin | 09/06/23 | 9,990 | LociOiling | 9,988 | LociOiling | 9,990 | Anthropic Dreams | Hat trick! |
| 2349: Revisiting Puzzle 94: Mouse | 09/16/23 | 9,991 | NinjaGreg | 9,989 | Bruno Kestemont | 9,991 | Go Science | This one had the wrong title, it was in fact 93 spider toxin again. |
| 2569: Revisiting Puzzle 93: Spider Toxin | 02/12/25 | 10,012 | Galaxie | 10,012 | Galaxie | 10,012 | Anthropic Dreams | Hat trick, Galaxie! |