Foldit Wiki
Advertisement
Irc 785738 1491533145 G1 Go Science E1 toshiue 9542

toshiue's spider toxin from puzzle 1359.

93: Spider Toxin is a revisiting puzzle, originally presented as Puzzle 93: Spider Toxin in 2008.

The toxin in this puzzle is from Agelenopsis aperta, known as the desert grass spider. This spider is native to the southwestern United States and Mexico, and seems relatively innocuous as compared to the cobras and scorpions that inhabit other revisiting puzzles.

The puzzle protein has 48 segments with the sequence:

kkkciakdygrckwggtpccrgrgcicsimgtnceckprlimeglgla

This sequence is found in these Protein Data Bank entries:

  • 1IVA (chain A, offset 0)
  • 1OAV (chain A, offset 0)
  • 1OAW (chain A, offset 0)
  • 2NDB (chain A, offset 1)

The puzzle protein can have four disulfide bridges, identified in 1IVA as 4-20, 12-25, 19-36, and 27-34. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

4,20 12,25 19,36 27,34

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
93: Spider Toxin 10/13/08 8,649 MellyLam 8,574 Aotearoa 8,649 Another Hour Another Point
834: Revisiting Puzzle 93: Spider Toxin 01/22/14 8,882 gloverd 8,905 MaartenDesnouck 8,905 Anthropic Dreams
1143: Revisiting Puzzle 93: Spider Toxin 10/07/15 9,350 mirp 9,355 Paulo Roque 9,355 Go Science
1359: Revisiting Puzzle 93: Spider Toxin 04/06/17 9,541 Z7ro 9,542 toshiue 9,542 Go Science
1620: Revisiting Puzzle 93: Spider Toxin 01/16/19 9,996 dcrwheeler 9,883 Bruno Kestemont 9,910 Void Crushers
1801: Revisiting Puzzle 93: Spider Toxin 02/18/20 10,101 crpainter 9,945 ZeroLeak7 9,945 Go Science
2080: Revisiting Puzzle 93: Spider Toxin 12/16/21 9,963 LociOiling 9,962 LociOiling 9,963 Beta Folders Hat trick!
2346: Revisiting Puzzle 93: Spider Toxin 09/06/23 9,990 LociOiling 9,988 LociOiling 9,990 Anthropic Dreams Hat trick!
2349: Revisiting Puzzle 94: Mouse 09/16/23 9,991 NinjaGreg 9,989 Bruno Kestemont 9,991 Go Science This one had the wrong title, it was in fact 93 spider toxin again.
2569: Revisiting Puzzle 93: Spider Toxin 02/12/25 10,012 Galaxie 10,012 Galaxie 10,012 Anthropic Dreams Hat trick, Galaxie!
Advertisement