Revisiting puzzle/91: Virus Protein

frood66's virus protein from Puzzle 1139.

91: Virus Protein is a Foldit revisiting puzzle, originally presented as Puzzle 91: Viral Protein in 2008. (The term "viral protein" changed to the more accurate "virus protein" in 2015.)

The protein in this puzzle is found in viruses known as bacteriophages, or just phages. The protein helps the virus infect the bacteria Escherichia coli, generally known as E. coli,

The puzzle protein has 70 segments with the sequence:

etvesclakphtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpiglaipenaaah

The sequence is found in these Protein Data Bank entries:

• 1FGP (chain A, offset 0)
• 2G3P (chains A, B; offset 0)

The puzzle protein can have two disulfide bridges, identified in 1FGP as 6-35 and 45-52. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the (corrected) bridges in this format:

6,35 45,52

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

• Puzzle 829
• Puzzle 1139
• Puzzle 1614
• Puzzle 2075

Complete series of revisits with top scores:

puzzle	closed	top solo score	top solo	top evo score	top evo	top group score	top group	comments
91: Viral Protein	10/08/08	9,332	Steven Pletsch	9,365	Steven Pletsch	9,365	Another Hour Another Point
829: Revisiting Puzzle 91: Viral Protein	01/08/14	9,620	retiredmichael	9,169	smilingone	9,620	Beta Folders
1139: Revisiting Puzzle 91: Virus Protein	09/23/15	9,320	frood66	9,343	actiasluna	9,343	Gargleblasters
1354: Revisiting Puzzle 91: Virus Protein	03/15/17	9,593	susume	9,604	Galaxie	9,604	Anthropic Dreams
1614: Revisiting Puzzle 91: Virus Protein	01/02/19	10,461	matosfran	10,496	smilingone	10,496	Beta Folders
1795: Revisiting Puzzle 91: Virus Protein	02/12/20	10,539	Aubade01	10,501	toshiue	10,501	Go Science
2075: Revisiting Puzzle 91: Virus Protein	12/02/21	10,481	grogar7	10,488	Galaxie	10,488	Anthropic Dreams
2340: Revisiting Puzzle 91: Virus Protein	08/23/23	10,551	LociOiling	10,550	LociOiling	10,551	Anthropic Dreams	Hat trick, Loci!