
frood66's virus protein from Puzzle 1139.
91: Virus Protein is a Foldit revisiting puzzle, originally presented as Puzzle 91: Viral Protein in 2008. (The term "viral protein" changed to the more accurate "virus protein" in 2015.)
The protein in this puzzle is found in viruses known as bacteriophages, or just phages. The protein helps the virus infect the bacteria Escherichia coli, generally known as E. coli,
The puzzle protein has 70 segments with the sequence:
etvesclakphtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpiglaipenaaah
The sequence is found in these Protein Data Bank entries:
The puzzle protein can have two disulfide bridges, identified in 1FGP as 6-35 and 45-52. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the (corrected) bridges in this format:
6,35 45,52
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
91: Viral Protein | 10/08/08 | 9,332 | Steven Pletsch | 9,365 | Steven Pletsch | 9,365 | Another Hour Another Point | |
829: Revisiting Puzzle 91: Viral Protein | 01/08/14 | 9,620 | retiredmichael | 9,169 | smilingone | 9,620 | Beta Folders | |
1139: Revisiting Puzzle 91: Virus Protein | 09/23/15 | 9,320 | frood66 | 9,343 | actiasluna | 9,343 | Gargleblasters | |
1354: Revisiting Puzzle 91: Virus Protein | 03/15/17 | 9,593 | susume | 9,604 | Galaxie | 9,604 | Anthropic Dreams | |
1614: Revisiting Puzzle 91: Virus Protein | 01/02/19 | 10,461 | matosfran | 10,496 | smilingone | 10,496 | Beta Folders | |
1795: Revisiting Puzzle 91: Virus Protein | 02/12/20 | 10,539 | Aubade01 | 10,501 | toshiue | 10,501 | Go Science | |
2075: Revisiting Puzzle 91: Virus Protein | 12/02/21 | 10,481 | grogar7 | 10,488 | Galaxie | 10,488 | Anthropic Dreams |