FANDOM


Irc 288912 1443027595 S1 frood66

frood66's virus protein from Puzzle 1139.

91: Virus Protein is a Foldit revisiting puzzle, originally presented as Puzzle 91: Viral Protein in 2008. (The term "viral protein" changed to the more accurate "virus protein" in 2015.)

The protein in this puzzle is found in viruses known as bacteriophages, or just phages. The protein helps the virus infect the bacteria Escherichia coli, generally known as E. coli,

The puzzle protein has 70 segments with the sequence:

etvesclakphtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpiglaipenaaah

The sequence is found in these Protein Data Bank entries:

  • 1FGP (chain A, offset 0)
  • 2G3P (chains A, B; offset 0)

The puzzle protein can have two disulfide bridges, identified in 1FGP as 6-35 and 45-52. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the (corrected) bridges in this format:

6,35 45,52

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
91: Viral Protein 10/08/08 9,332 Steven Pletsch 9,365 Steven Pletsch 9,365 Another Hour Another Point
829: Revisiting Puzzle 91: Viral Protein 01/08/14 9,620 retiredmichael 9,169 smilingone 9,620 Beta Folders
1139: Revisiting Puzzle 91: Virus Protein 09/23/15 9,320 frood66 9,343 actiasluna 9,343 Gargleblasters
1354: Revisiting Puzzle 91: Virus Protein 03/15/17 9,593 susume 9,604 Galaxie 9,604 Anthropic Dreams
1614: Revisiting Puzzle 91: Virus Protein 01/02/19 10,461 matosfran 10,496 smilingone 10,496 Beta Folders
1795: Revisiting Puzzle 91: Virus Protein 02/12/20 10,539 Aubade01 10,501 toshiue 10,501 Go Science
Community content is available under CC-BY-SA unless otherwise noted.