
retiredmichael's heliomicin from Puzzle 829.
90: Heliomicin is a Foldit revisiting puzzle, originally presented as Puzzle 90: Heliomicin in 2008.
Heliomicin is an anti-fungal protein produced by the moth Heliothis virescens, commonly known as the tobacco budworm. Heliomicin is a type of defensin, proteins which guard against fungi, bacteria, and viruses.
The puzzle protein has 44 segments with the sequence:
dkligscvwgavnytsdcngeckrrgykgghcgsfanvncwcet
The sequence is found in this Protein Data Bank entry:
- 1I2U (chain A, offset 0)
The puzzle protein can have three disulfide bridges, identified in 1I2U as 7-32, 18-40, and 22-42. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
7,32 18,40 22,42
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
90: Heliomicin | 10/06/08 | 8,762 | jobo0502 | 8,778 | g_s | 8,778 | Another Hour Another Point | |
824: Revisiting Puzzle 90: Heliomicin | 01/02/14 | 8,955 | hansvandenhof | 8,952 | Galaxie | 8,955 | Anthropic Dreams | |
1136: Revisiting Puzzle 90: Heliomicin | 09/16/15 | 9,266 | BitSpawn | 9,258 | gmn | 9,266 | Anthropic Dreams | |
1351: Revisiting Puzzle 90: Heliomicin | 03/16/17 | 9,419 | LociOiling | 9,419 | reefyrob | 9,419 | Beta Folders | |
1611: Revisiting Puzzle 90: Heliomicin | 12/26/18 | 9,813 | tyler0911 | 9,831 | Galaxie | 9,813 | Anthropic Dreams | |
1792: Revisiting Puzzle 90: Heliomicin | 02/05/20 | 9,841 | Timo van der Laan | 9,818 | NinjaGreg | 9,841 | Void Crushers | |
2072: Revisiting Puzzle 90: Heliomicin | 11/25/21 | 9,795 | guineapig | 9,804 | guineapig | 9,788 | Contenders | |
2337: Revisiting Puzzle 90: Heliomicin | 08/16/23 | 9,834 | LociOiling | 9,834 | LociOiling | 9,834 | Anthropic Dreams | Hat trick, Loci! |
2561: Revisiting Puzzle 90: Heliomicin | 01/22/25 | 9,849 | LociOiling | 9,850 | LociOiling | 9,850 | Anthropic Dreams | Hat trick, Loci! |