FANDOM


Irc 188194 1387410210 S1 jermainiac

jermaniac's cow eye crystallin from Puzzle 821.

89: Cow Eye is a Foldit revisiting puzzle, originally presented as Puzzle 89: Cow Eye in 2008.

The protein in this puzzle is type of crystallin, a transparent protein found in eyes. As the puzzle name implies, this particular protein is found in cow eyes. There are several types of crystallin, and this protein is considered a "gamma b" type, corresponding to the human gene CRYGB.

The puzzle protein has 88 segments with the sequence:

tfrmriyerddfrgqmseitddcpslqdrfhltevhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmdfy

The sequence is found in these Protein Data Bank entries:

  • 4W9B (chain A, offset 87)
  • 4W9A (chain A, offset 87)
  • 4GCR (chain A, offset 86)
  • 1I5I (chain A, offset 86)
  • 1GCS (chain A, offset 86)
  • 1DSL (chain A, offset 60)
  • 1AMM (chain A, offset 86)

The puzzle protein does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
89: Cow Eye 10/03/08 10,654 Rhyslarn 10,655 Madde 10,655 Void Crushers
821: Revisiting Puzzle 89: Cow Eye 12/18/13 10,817 jermaniac 10,823 auntdeen 10,823 Anthropic Dreams
1133: Revisiting Puzzle 89: Cow Eye 09/08/15 9,442 johnmitch 9,447 smilingone 9,447 Beta Folders
1345: Revisiting Puzzle 89: Cow Eye 03/03/17 9,690 markm457 9,689 Galaxie 9,690 Anthropic Dreams
1348: Revisiting Puzzle 89: Cow Eye 03/10/17 15,019 bertro 15,020 smilingone 15,020 Beta Folders
1607: Revisiting Puzzle 89: Cow Eye 12/12/18 11,277 retiredmichael 11,288 LociOiling 11,288 Beta Folders
1789: Revisiting Puzzle 89: Cow Eye 01/29/20 11,311 O Seki To 11,287 Bletchley Park 11,331 Hun-Magyar Csapat
Community content is available under CC-BY-SA unless otherwise noted.