Mirp's zinc binding protein from puzzle 815.
87: Zinc Binding Protein is a revisiting puzzle, originally presented as Puzzle 87: Zinc Binding Protein in 2008.
The small protein in this puzzle can bind to a single zinc atom, but the zinc atom does not appear in Foldit.
The puzzle protein has 39 segments with the sequence:
ekcsehderlklyckddgtlscvicrdslkhashnflpi
This sequence is found in this Protein Data Bank entry:
- 1FRE (chain A; offset 3)
The puzzle protein does not form disulfide bridges, although it does have several cysteine segments.
The recipe Missing Ligand 1.0.1 -- brow42 can be used to create bands that simulate the missing zinc atom. Select the "zinc finger" option on the first screen, then pick one of the geometries on the second screen and click "Band". If your choice is good, wiggling and shaking may pull the protein into a better shape.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 87: Zinc Binding Protein | 09/29/08 | 8,580 | bzipitido | 8,595 | gla | 8,595 | Void Crushers | |
| 815: Revisiting Puzzle 87: Zinc Binding Protein | 12/04/13 | 8,828 | karstenw | 8,822 | gmn | 8,828 | Anthropic Dreams | |
| 1127: Revisiting Puzzle 87: Zinc Binding Protein | 08/25/15 | 8,382 | jermaniac | 8,383 | Blipperman | 8,383 | Gargleblasters | |
| 1337: Revisiting Puzzle 87: Zinc Binding Protein | 02/10/17 | 8,570 | Galaxie | 8,571 | Galaxie | 8,571 | Anthropic Dreams | |
| 1601: Revisiting Puzzle 87: Zinc Binding Protein | 11/28/18 | 9,086 | Waya | 9,093 | Galaxie | 9,093 | Anthropic Dreams | |
| 1783: Revisiting Puzzle 87: Zinc Binding Protein | 01/15/20 | 9,093 | ZeroLeak7 | 9,095 | mirp | 9,095 | Go Science | |
| 2060: Revisiting Puzzle 87: Zinc Binding Protein | 10/28/21 | 9,113 | Skippysk8s | 9,119 | Angus | 9,119 | Beta Folders | |
| 2328: Revisiting Puzzle 87: Zinc Binding Protein | 07/26/23 | 9,180 | LociOiling | 9,171 | Galaxie | 9,180 | Anthropic Dreams |