Changes: Revisiting puzzle/87: Zinc Binding Protein

Revision as of 07:46, 2 July 2019

Irc 435881 1386223263 S2 mirp — Mirp's zinc binding protein from puzzle 815.

87: Zinc Binding Protein is a revisiting puzzle, originally presented as Puzzle 87: Zinc Binding Protein in 2008.

The small protein in this puzzle can bind to a single zinc atom, but the zinc atom does not appear in Foldit.

The puzzle protein has 39 segments with the sequence:

ekcsehderlklyckddgtlscvicrdslkhashnflpi

This sequence is found in this Protein Data Bank entry:

1FRE (chain A; offset 3)

The puzzle protein does not form disulfide bridges, although it does have several cysteine segments.

The recipe Missing Ligand 1.0.1 -- brow42 can be used to create bands that simulate the missing zinc atom. Select the "zinc finger" option on the first screen, then pick one of the geometries on the second screen and click "Band". If your choice is good, wiggling and shaking may pull the protein into a better shape.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

@@ Line 1: / Line 1: @@
-Revisiting puzzle/Zinc Binding Protein
 [[File:Irc_435881_1386223263_S2_mirp.png|thumb|400px|Mirp's zinc binding protein from [[Puzzle_815|puzzle 815]].]]
-[[Revisiting puzzle/Zinc Binding Protein|Zinc Binding Protein]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented as [https://fold.it/portal/node/451446 Puzzle 87: Zinc Binding Protein] in 2008.
+[[Revisiting puzzle/87: Zinc Binding Protein|87: Zinc Binding Protein]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented as [https://fold.it/portal/node/451446 Puzzle 87: Zinc Binding Protein] in 2008.
 The small protein in this puzzle can bind to a single zinc atom, but the zinc atom does not appear in Foldit.