Bruno Kestemont's nematode anticoagulant from Puzzle 1124.
86: Nematode is a Foldit revisiting puzzle, originally presented as Puzzle 86: Nematode in 2008.
The protein in this puzzle is an anticoagulant from a nematode, Ancylostoma caninum, a hookworm which primarily infects dogs.
The puzzle protein has 85 segments with the sequence:
katmqcgenekydscgskecdkkckydgveeeddeepnvpclvrvchqdcvceegfyrnkddkcvsaedceldnmdfiypgtrnp
The sequence is found in these Protein Data Bank entries:
The puzzle protein can have five disulfide bridges, identified in 1COU as 6-50, 15-46, 20-41, 24-70, and 52-64. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points. The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
6,50 15,46 20,41 24,70 52,64
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 86: Nematode | 09/26/08 | 9,345 | unHandyAndy | 9,311 | g_s | 9,311 | Another Hour Another Point | |
| 812: Revisiting Puzzle 86: Nematode | 11/27/13 | 9,807 | dembones | 9,834 | martinzblavy | 9,834 | Contenders | |
| 1124: Revisiting Puzzle 86: Nematode | 08/18/15 | 9,951 | Bruno Kestemont | 10,031 | gloverd | 10,031 | Go Science | |
| 1333: Revisiting Puzzle 86: Nematode | 02/01/17 | 10,295 | reefyrob | 10,316 | smilingone | 10,316 | Beta Folders | |
| 1599: Revisiting Puzzle 86: Nematode | 11/20/18 | 10,283 | tyler0911 | 10,310 | Galaxie | 10,310 | Anthropic Dreams | |
| 1780: Revisiting Puzzle 86: Nematode | 01/08/20 | 11,104 | grogar7 | 11,098 | Galaxie | 11,098 | Anthropic Dreams | |
| 12057: Revisiting Puzzle 86: Nematode | 10/14/21 | 11,251 | LociOiling | 11,259 | jausmh | 11,259 | Marvin's Bunch |
