Foldit Wiki
Advertisement

Bruno Kestemont's nematode anticoagulant from Puzzle 1124.

86: Nematode is a Foldit revisiting puzzle, originally presented as Puzzle 86: Nematode in 2008.

The protein in this puzzle is an anticoagulant from a nematode, Ancylostoma caninum, a hookworm which primarily infects dogs.

The puzzle protein has 85 segments with the sequence:

katmqcgenekydscgskecdkkckydgveeeddeepnvpclvrvchqdcvceegfyrnkddkcvsaedceldnmdfiypgtrnp

The sequence is found in these Protein Data Bank entries:

  • 1COU (chain A, offset 0)
  • 2H9E (chain C, offset 0, matches segments 1-84)

The puzzle protein can have five disulfide bridges, identified in 1COU as 6-50, 15-46, 20-41, 24-70, and 52-64. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points. The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

6,50 15,46 20,41 24,70 52,64

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
86: Nematode 09/26/08 9,345 unHandyAndy 9,311 g_s 9,311 Another Hour Another Point
812: Revisiting Puzzle 86: Nematode 11/27/13 9,807 dembones 9,834 martinzblavy 9,834 Contenders
1124: Revisiting Puzzle 86: Nematode 08/18/15 9,951 Bruno Kestemont 10,031 gloverd 10,031 Go Science
1333: Revisiting Puzzle 86: Nematode 02/01/17 10,295 reefyrob 10,316 smilingone 10,316 Beta Folders
1599: Revisiting Puzzle 86: Nematode 11/20/18 10,283 tyler0911 10,310 Galaxie 10,310 Anthropic Dreams
1780: Revisiting Puzzle 86: Nematode 01/08/20 11,104 grogar7 11,098 Galaxie 11,098 Anthropic Dreams
12057: Revisiting Puzzle 86: Nematode 10/14/21 11,251 LociOiling 11,259 jausmh 11,259 Marvin's Bunch
Advertisement