FANDOM


Irc 352715 1485372011 S2 Galaxie 8943

Galaxie's cell adhesion protein from puzzle 1330.

85: Cell Adhesion Protein is a revisiting puzzle, originally presented as Puzzle 85: Cell Adhesion Protein in 2008.

(See cell adhesion for the similarly-named series of revisiting puzzles based on puzzle 136.)

The protein in this puzzle is known as the ILK-PINCH complex. ILK is integrin-linked kinase. PINCH is "Particularly interesting new cysteine-histidine rich protein". Together, ILK and PINCH influence both how cell stick together ("cell adhesion") and how they migrate.

The puzzle protein has 70 segments with the sequence:

manalasatcerckggfapaekivnsngelyheqcfvcaqcfqqfpeglfyefegrkycehdfqmlfapc 

This sequence is found in these Protein Data Bank entries:

  • 2KBX (chain B, offset 0)
  • 1G47 (chain A, offset 4)

While the protein has several cysteines, it's not expected to form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
85: Cell Adhesion Protein 09/24/08 9,057 Steven Pletsch 9,152 Steven Pletsch 9,152 Another Hour Another Point
809: Revisiting Puzzle 85: Cell Adhesion Protein 11/20/13 9,501 wisky 9,504 MurloW 9,504 Anthropic Dreams
1122: Revisiting Puzzle 85: Cell Adhesion Protein 08/11/15 8,513 pauldunn 8,540 Bruno Kestemont 8,540 Go Science
1330: Revisiting Puzzle 85: Cell Adhesion Protein 01/25/17 8,948 retiredmichael 8,955 smilingone 8,955 Beta Folders
1596: Revisiting Puzzle 85: Cell Adhesion Protein 11/13/18 9,867 Galaxie 9,902 Galaxie 9,902 Anthropic Dreams
1777: Revisiting Puzzle 85: Cell Adhesion Protein 01/01/20 9,915 LociOiling 9,908 LociOilng 9,915 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.