
auntdeen's cytotoxin from puzzle 800.
82: Cytotoxin is a revisiting puzzle, originally presented as Puzzle 82: Cytotoxin in 2008.
As the name implies, this puzzle involves a toxin, a popular subject for revisiting puzzles. The toxin in this puzzle comes from the venom of the Mozambique spitting cobra (Naja mossambica mossambica), an animal described as "nervous and temperamental" in its wikipedia article.
The puzzle protein has 60 segments with the sequence:
lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn
This sequence is found in this Protein Data Bank entry:
- 1CDT (chains A, B; offset 0)
The puzzle protein can have four disulfide bridges, identified in 1CDT as 3-21, 14-38, 42-53, and 54-59. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
3,21 14,38 42,53 54,59
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
82: Cytotoxin | 09/15/08 | 8,867 | zim57 | 8,848 | g_s | 8,852 | Skeptics Guide to the Universe | |
800: Revisiting Puzzle 82: Cytotoxin | 10/30/13 | 9,094 | auntdeen | 9,102 | spdenne | 9,102 | Void Crushers | |
1113: Revisiting Puzzle 82: Cytotoxin | 07/21/15 | 9,204 | nicobul | 9,191 | Museka | 9,204 | L'Alliance Francophone | difficult to find! |
1320: Revisiting Puzzle 82: Cytotoxin | 01/03/17 | 9,707 | fiendish_ghoul | 9,701 | smilingone | 9,701 | Beta Folders | |
1586: Revisiting Puzzle 82: Cytotoxin | 10/18/18 | 10,426 | retiredmichael | 10,439 | LociOiling | 10,439 | Beta Folders | |
1768: Revisiting Puzzle 82: Cytotoxin | 12/11/19 | 10,428 | LociOiling | 10,428 | LociOiling | 10,428 | Beta Folders |