auntdeen's cytotoxin from puzzle 800.

82: Cytotoxin is a revisiting puzzle, originally presented as Puzzle 82: Cytotoxin in 2008.

As the name implies, this puzzle involves a toxin, a popular subject for revisiting puzzles. The toxin in this puzzle comes from the venom of the Mozambique spitting cobra (Naja mossambica mossambica), an animal described as "nervous and temperamental" in its wikipedia article.

The puzzle protein has 60 segments with the sequence:

lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn 

This sequence is found in this Protein Data Bank entry:

  • 1CDT (chains A, B; offset 0)

The puzzle protein can have four disulfide bridges, identified in 1CDT as 3-21, 14-38, 42-53, and 54-59. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

3,21 14,38 42,53 54,59 

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
82: Cytotoxin 09/15/08 8,867 zim57 8,848 g_s 8,852 Skeptics Guide to the Universe
800: Revisiting Puzzle 82: Cytotoxin 10/30/13 9,094 auntdeen 9,102 spdenne 9,102 Void Crushers
1113: Revisiting Puzzle 82: Cytotoxin 07/21/15 9,204 nicobul 9,191 Museka 9,204 L'Alliance Francophone difficult to find!
1320: Revisiting Puzzle 82: Cytotoxin 01/03/17 9,707 fiendish_ghoul 9,701 smilingone 9,701 Beta Folders
1586: Revisiting Puzzle 82: Cytotoxin 10/18/18 10,426 retiredmichael 10,439 LociOiling 10,439 Beta Folders
1768: Revisiting Puzzle 82: Cytotoxin 12/11/19 10,428 LociOiling 10,428 LociOiling 10,428 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.