FANDOM


Irc 447652 1482273702 S1 Bruno Kestemont

Bruno Kestemont's Troponin C from puzzle 1318.

81: Calcium Ion Binding Protein is a revisiting puzzle, originally presented as Puzzle 81: Calcium Ion Binding Protein in 2009.

The protein in this puzzle is Troponin C, also known as TN-C or TnC. Its calcium ion binding properties are important in the function of the heart and others muscles.

The puzzle protein has 81 segments with the sequence:

qaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevdedgsgtidfeeflvmmvrqmk 

(A shorter version of the same sequence, missing the first five segments, is found in the Turkey revisiting puzzle.)

This sequence is found in these Protein Data Bank entries:

  • 5TNC (chain A, offset 6)
  • 4TNC (chain A, offset 6)
  • 2W4U (chains 0, 3, 6, 9, offset 3)
  • 2W49 (chains 0, 3, 6, 9, offset 3)
  • 1ZAC (chain A, offset 6)
  • 1YV0 (chain C, offset 6)
  • 1YTZ (chain C, offset 6)
  • 1TOP (chain A, offset 6)
  • 1TNX (chain A, offset 6)
  • 1TNW (chain A, offset 6)
  • 1TNQ (chain A, offset 6)

among others.

The puzzle protein does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
81: Calcium Ion Binding Protein 09/12/08 9,917 zim57 9,914 Steven Pletsch 9,914 Another Hour Another Point
793: Revisiting Puzzle 81: Calcium Ion Binding Protein 10/16/13 10,048 utaca 10,060 gitwut 10,060 Contenders
1110: Revisiting Puzzle 81: Calcium Ion Binding Protein 07/14/15 9,083 LociOiling 9,094 smilingone 9,094 Beta Folders
1318: Revisiting Puzzle 81: Calcium Ion Binding Protein 12/20/16 9,489 Bruno Kestemont 9,490 Bruno Kestemont 9,490 Go Science
1577: Revisiting Puzzle 81: Calcium Ion Binding Protein 10/02/18 10,770 LociOiling 10,763 LociOiling 10,770 Beta Folders
1765: Revisiting Puzzle 81: Calcium Ion Binding Protein 12/04/19 10,835 Aubade01 10,819 LociOiling 10,819 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.