
Bruno Kestemont's Troponin C from puzzle 1318.
81: Calcium Ion Binding Protein is a revisiting puzzle, originally presented as Puzzle 81: Calcium Ion Binding Protein in 2009.
The protein in this puzzle is Troponin C, also known as TN-C or TnC. Its calcium ion binding properties are important in the function of the heart and others muscles.
The puzzle protein has 81 segments with the sequence:
qaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevdedgsgtidfeeflvmmvrqmk
(A shorter version of the same sequence, missing the first five segments, is found in the Turkey revisiting puzzle.)
This sequence is found in these Protein Data Bank entries:
- 5TNC (chain A, offset 6)
- 4TNC (chain A, offset 6)
- 2W4U (chains 0, 3, 6, 9, offset 3)
- 2W49 (chains 0, 3, 6, 9, offset 3)
- 1ZAC (chain A, offset 6)
- 1YV0 (chain C, offset 6)
- 1YTZ (chain C, offset 6)
- 1TOP (chain A, offset 6)
- 1TNX (chain A, offset 6)
- 1TNW (chain A, offset 6)
- 1TNQ (chain A, offset 6)
among others.
The puzzle protein does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits this puzzle:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
81: Calcium Ion Binding Protein | 09/12/08 | 9,917 | zim57 | 9,914 | Steven Pletsch | 9,914 | Another Hour Another Point | |
793: Revisiting Puzzle 81: Calcium Ion Binding Protein | 10/16/13 | 10,048 | utaca | 10,060 | gitwut | 10,060 | Contenders | |
1110: Revisiting Puzzle 81: Calcium Ion Binding Protein | 07/14/15 | 9,083 | LociOiling | 9,094 | smilingone | 9,094 | Beta Folders | |
1318: Revisiting Puzzle 81: Calcium Ion Binding Protein | 12/20/16 | 9,489 | Bruno Kestemont | 9,490 | Bruno Kestemont | 9,490 | Go Science | |
1577: Revisiting Puzzle 81: Calcium Ion Binding Protein | 10/02/18 | 10,770 | LociOiling | 10,763 | LociOiling | 10,770 | Beta Folders | |
1765: Revisiting Puzzle 81: Calcium Ion Binding Protein | 12/04/19 | 10,835 | Aubade01 | 10,819 | LociOiling | 10,819 | Beta Folders | |
2042: Revisiting Puzzle 81: Calcium Ion | 09/16/21 | 10,734 | Enzyme | 10,736 | Beany | 10,735 | Gargleblasters |