FANDOM


Irc 455069 1436247726 S1 retiredmichael

retiredmicael's calcium channel blocker from puzzle 1107.

80: Calcium Channel Blocker is a revisiting puzzle, originally presented as Puzzle 80: Calcium Channel Blocker in 2009.

The protein in this puzzle is calcicludine. Like many of the revisiting puzzle proteins, it's from a toxin, which is found in the venom of the green mamba. It's known to act on heart and brain cells in rats, but the exact mechanism is not fully understood.

The protein has 60 segments with the sequence:

wqppwyckepvrigsckkqfssfyfkwtakkclpflfsgcggnanrfqtigecrkkclgku

This sequence is found in these Protein Data Bank entries:

  • 1BF0 (chain A, offset 0)
  • 5YV7 (chain A, offset 0)

The protein can have three disulfide bridges, identified in 1BF0 as 7-57, 16-40, and 32-53. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

7,57 16,40 32,53

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
80: Calcium Channel Blocker 09/10/08 9,048 Huzar 9,086 g_s 9,086 Another Hour Another Point
797: Revisiting Puzzle 80: Calcium Channel Blocker 10/16/13 9,254 Hanto_FZ140E_4G 9,249 Hanto_FZ140E_4G 9,254 Clear The Way
1107: Revisiting Puzzle 80: Calcium Channel Blocker 07/07/15 9,463 retiredmichael 9,484 smilingone 9,484 Beta Folders
1314: Revisiting Puzzle 80: Calcium Channel Blocker 12/13/16 9,560 dembones 9,570 Bletchley Park 9,570 Contenders
1575: Revisiting Puzzle 80: Calcium Channel Blocker 09/26/18 10,112 hpaege 10,101 jausmh 10,101 Marvin's Bunch
1762: Revisiting Puzzle 80: Calcium Channel Blocker 11/27/19 10,346 Timo van der Laan 10,305 LociOiling 10,346 Void Crushers
Community content is available under CC-BY-SA unless otherwise noted.