FANDOM


Irc 455069 1436247726 S1 retiredmichael

retiredmicael's calcium channel blocker from puzzle 1107.

80: Calcium Channel Blocker is a revisiting puzzle, originally presented as Puzzle 80: Calcium Channel Blocker in 2009.

The protein in this puzzle is calcicludine. Like many of the revisiting puzzle proteins, it's from a toxin, which is found in the venom of the green mamba. It's known to act on heart and brain cells in rats, but the exact mechanism is not fully understood.

The protein has 60 segments with the sequence:

wqppwyckepvrigsckkqfssfyfkwtakkclpflfsgcggnanrfqtigecrkkclgku

This sequence is found in these Protein Data Bank entries:

  • 1BF0 (chain A, offset 0)
  • 5YV7 (chain A, offset 0)

The protein can have three disulfide bridges, identified in 1BF0 as 7-57, 16-40, and 32-53. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

7,57 16,40 32,53

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.