FANDOM


Irc 476462 1435100844 S2 LociOiling

LociOiling's copZ from puzzle 1101.

77: Copper Chaperone is a revisiting puzzle, originally presented in 2009 as Puzzle 77: Gene Regulation Protein. On subsequent revisits, the term "copper chaperone" has replaced "gene regulation protein".

The protein in this puzzle is known as CopZ, and is involved in transporting copper ions.

The protein has 68 segments with the sequence:

aqefsvkgmscnhcvarieeavgrisgvkkvkvqlkkekavvkfdeanvqateicqainelgyqaevi

This sequence is found in this Protein Data Bank entry:

  • 1CPZ (chain A, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.