FANDOM


Irc 476462 1435100844 S2 LociOiling

LociOiling's copZ from puzzle 1101.

77: Copper Chaperone is a revisiting puzzle, originally presented in 2009 as Puzzle 77: Gene Regulation Protein. On subsequent revisits, the term "copper chaperone" has replaced "gene regulation protein".

The protein in this puzzle is known as CopZ, and is involved in transporting copper ions.

The protein has 68 segments with the sequence:

aqefsvkgmscnhcvarieeavgrisgvkkvkvqlkkekavvkfdeanvqateicqainelgyqaevi

This sequence is found in this Protein Data Bank entry:

  • 1CPZ (chain A, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
77: Gene Regulation Protein 09/03/08 9,568 MattSaffell 9,570 Steven Pletsch 9,570 Another Hour Another Point
785: Revisiting Puzzle 77: Gene Regulation Protein 10/02/13 9,777 spmm 9,773 spdenne 9,777 Void Crushers
1101: Revisiting Puzzle 77: Copper Chaperone 06/23/15 8,944 frood66 8,960 Blipperman 8,960 Gargleblasters
1308: Revisiting Puzzle 77: Copper Chaperone 11/29/16 9,219 fiendish_ghoul 9,193 Galaxie 9,196 Anthropic Dreams
1568: Revisiting Puzzle 77: Copper Chaperone 08/29/18 10,371 LociOiling 10,365 LociOiling 10,371 Beta Folders
1756: Revisiting Puzzle 77: Copper Chaperone 11/13/19 10,334 ZeroLeak7 10,345 retiredmichael 10,345 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.