LociOiling (talk | contribs) m (LociOiling moved page Revisiting puzzle/Antifreeze Protein to Revisiting puzzle/75: Antifreeze Protein: New standard.) |
LociOiling (talk | contribs) (Original puzzle number now part of the name.) |
||
Line 1: | Line 1: | ||
[[File:Irc 190318 1433750142 S1 BitSpawn.png|thumb|400px|BitSpawn's AFP from [[Puzzle 1095|puzzle 1095]].]] |
[[File:Irc 190318 1433750142 S1 BitSpawn.png|thumb|400px|BitSpawn's AFP from [[Puzzle 1095|puzzle 1095]].]] |
||
− | [[Revisiting_puzzle/Antifreeze Protein|Antifreeze Protein]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented in 2008 as [https://fold.it/portal/node/395222 Puzzle 75: Antifreeze Protein]. |
+ | [[Revisiting_puzzle/75: Antifreeze Protein|75: Antifreeze Protein]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented in 2008 as [https://fold.it/portal/node/395222 Puzzle 75: Antifreeze Protein]. |
The protein in this puzzle is an antifreeze protein (AFP), which cold water fishes use to keep from freezing. This protein is from a type of fish known as an eelpout, specifically an [[wikipedia:Ocean_pout|ocean pout]], ''Zoarces americanus''. |
The protein in this puzzle is an antifreeze protein (AFP), which cold water fishes use to keep from freezing. This protein is from a type of fish known as an eelpout, specifically an [[wikipedia:Ocean_pout|ocean pout]], ''Zoarces americanus''. |
Revision as of 05:44, 2 July 2019
75: Antifreeze Protein is a revisiting puzzle, originally presented in 2008 as Puzzle 75: Antifreeze Protein.
The protein in this puzzle is an antifreeze protein (AFP), which cold water fishes use to keep from freezing. This protein is from a type of fish known as an eelpout, specifically an ocean pout, Zoarces americanus.
The same protein also appears in the Ice Binding series of revisiting puzzles.
The antifreeze AFPs are not be confused with alpha-fetoprotein, also known as AFP.
The puzzle has 66 segments with the sequence:
anqasvvanqlipintaltlvmmrsevvtpvgipaediprlvsmqvnravplgttlmpdmvrgyaa
This sequence is found in the following Protein Data Bank entry:
- 1B7I (chain A, offset 0)
There are also other PDB entries which match 65 out of 66 segments:
In 1AME and 5C7R, the mismatch is at segment 62 of the Foldit protein. In both cases, the arginine (R) at segment 62 is lysine (K) in the PDB protein.
This puzzle does not have disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle: