FANDOM


Irc 253386 1433168243 S1 bertro

Bertro's platypus venom from puzzle 1092.

74: Platypus Venom is a revisiting puzzle, originally presented in 2008 as Puzzle 74: Platypus Venom.

As the title suggests, the protein is a component of platypus venom.

The puzzle has 42 segments with the sequence:

 
fvqhrprdcesingvcrhkdtvncreifladcyndgqkccrk

This sequence is found in the following Protein Data Bank entry:

  • 1B8W (chain A, offset 0)

This puzzle can have three disulfide bridges. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

9,39 16,32 24,40

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
74: Platypus Venom 08/25/08 8,696 csohad 8,698 misiaczowski 8,698 Another Hour Another Point
774: Revisiting Puzzle 74: Platypus Venom 09/11/13 8,902 dembones 8,899 gitwut 8,902 Contenders
1092: Revisiting Puzzle 74: Platypus Venom 06/01/15 9,156 bertro 9,163 LociOiling 9,163 Beta Folders
1295: Revisiting Puzzle 74: Platypus Venom 10/19/16 9,250 dcrwheeler 9,245 smilingone 9,245 Beta Folders
1559: Revisiting Puzzle 74: Platypus Venom 08/15/18 9,991 georg137 9,774 LociOiling 9,991 Contenders
1747: Revisiting Puzzle 74: Platypus Venom 10/23/19 9,721 retiredmichael 9,735 LociOiling 9,735 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.