watch 01:25
Jurassic World: Dominion Dominates Fandom Wikis - The Loop
Do you like this video?
Play Sound

Bertro's platypus venom from puzzle 1092.
74: Platypus Venom is a revisiting puzzle, originally presented in 2008 as Puzzle 74: Platypus Venom.
As the title suggests, the protein is a component of platypus venom.
The puzzle has 42 segments with the sequence:
fvqhrprdcesingvcrhkdtvncreifladcyndgqkccrk
This sequence is found in the following Protein Data Bank entry:
- 1B8W (chain A, offset 0)
This puzzle can have three disulfide bridges. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
9,39 16,32 24,40
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
74: Platypus Venom | 08/25/08 | 8,696 | csohad | 8,698 | misiaczowski | 8,698 | Another Hour Another Point | |
774: Revisiting Puzzle 74: Platypus Venom | 09/11/13 | 8,902 | dembones | 8,899 | gitwut | 8,902 | Contenders | |
1092: Revisiting Puzzle 74: Platypus Venom | 06/01/15 | 9,156 | bertro | 9,163 | LociOiling | 9,163 | Beta Folders | |
1295: Revisiting Puzzle 74: Platypus Venom | 10/19/16 | 9,250 | dcrwheeler | 9,245 | smilingone | 9,245 | Beta Folders | |
1559: Revisiting Puzzle 74: Platypus Venom | 08/15/18 | 9,991 | georg137 | 9,774 | LociOiling | 9,991 | Contenders | |
1747: Revisiting Puzzle 74: Platypus Venom | 10/23/19 | 9,721 | retiredmichael | 9,735 | LociOiling | 9,735 | Beta Folders | |
2028: Revisiting Puzzle 74: Platypus Venom | 08/12/21 | 9,781 | sallallami | 9,770 | toshiue | 9,770 | Go Science |