Galaxie's PKD from puzzle 1089.
73: Polycystein is a revisiting puzzle, originally presented in 2008 as 73: Polycystein.
The protein in this puzzle is a glycoprotein which has been linked to polycystic kidney disease in humans. The puzzle protein is called a PKD domain. "PKD" stands for "polycystic kidney disease" and "domain" refers to a section of protein that is found as a component of other, larger proteins.
The puzzle consists of the following amino acid sequence:
atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvtavlalgagsallgtdvqvea
This sequence is found in the following Protein Data Bank entry:
- 1B4R (chain A, offset -7)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 73: Polycystein | 08/21/08 | 9,782 | zim57 | 9,836 | gauchomurphy | 9,821 | Another Hour Another Point | |
| 770: Revisiting Puzzle 73: Polycystein | 09/04/13 | 10,099 | Alistair69 | 10,114 | nicobul | 10,114 | L'Alliance Francophone | |
| 1089: Revisiting Puzzle 73: Polycystein | 05/25/15 | 8,738 | mirp | 8,742 | Galaxie | 8,742 | Anthropic Dreams | |
| 1292: Revisiting Puzzle 73: Polycystein | 10/12/16 | 9,393 | retiredmichael | 9,396 | smilingone | 9,396 | Beta Folders | |
| 1556: Revisiting Puzzle 73: Polycystein | 08/08/18 | 10,614 | reefyrob | 10,617 | LociOiling | 10,617 | Beta Folders | |
| 1743: Revisiting Puzzle 73: Polycystein | 10/16/19 | 10,706 | ZeroLeak7 | 10,709 | ZeroLeak7 | 10,709 | Go Science | |
| 2025: Revisiting Puzzle 73: Polycystein | 07/29/21 | 10,752 | mirp | 10,751 | toshiue | 10,752 | Go Science | |
| 2025: Revisiting Puzzle 73: Polycystein | 07/29/21 | 10,752 | mirp | 10,751 | toshiue | 10,752 | Go Science | |
| 2283: Revisiting Puzzle 73: Polycystein | 10,695 | LociOiling | 10,699 | Galaxie | 10,699 | Anthropic Dreams |