Foldit Wiki
Don't have an account?
Register
Register
in: Revisiting Puzzle

Changes: Revisiting puzzle/73: Polycystein

< Revisiting puzzle
Back to page
Edit
(Original puzzle number now part of the name.)
(4th round of moving results)
Line 22: Line 22:
 
*[[Puzzle 770]]
  
*[[Puzzle 770]]
 
*[[Puzzle 1089]]
  
*[[Puzzle 1089]]
  +
*[[Puzzle 1556]]
  +
*[[Puzzle 1743]]
  +
Complete series of revisits with top scores:
  +
{| class="wikitable"
  +
|-
  +
!puzzle
  +
!closed
  +
!top solo score
  +
!top solo
  +
!top evo score
  +
!top evo
  +
!top group score
  +
!top group
  +
!comments
  +
|-
  +
|[https://fold.it/portal/node/380771 73: Polycystein]
  +
|08/21/08
  +
|9,782
  +
|zim57
  +
|9,836
  +
|gauchomurphy
  +
|9,821
  +
|Another Hour Another Point
  +
|
  +
|-
  +
|[https://fold.it/portal/node/995838 770: Revisiting Puzzle 73: Polycystein]
  +
|09/04/13
  +
|10,099
  +
|Alistair69
  +
|10,114
  +
|nicobul
  +
|10,114
  +
|L'Alliance Francophone
  +
|
  +
|-
  +
|[https://fold.it/portal/node/2000728 1089: Revisiting Puzzle 73: Polycystein]
  +
|05/25/15
  +
|8,738
  +
|mirp
  +
|8,742
  +
|Galaxie
  +
|8,742
  +
|Anthropic Dreams
  +
|
  +
|-
  +
|[https://fold.it/portal/node/2002906 1292: Revisiting Puzzle 73: Polycystein]
  +
|10/12/16
  +
|9,393
  +
|retiredmichael
  +
|9,396
  +
|smilingone
  +
|9,396
  +
|Beta Folders
  +
|
  +
|-
  +
|[https://fold.it/portal/node/2005546 1556: Revisiting Puzzle 73: Polycystein]
  +
|08/08/18
  +
|10,614
  +
|reefyrob
  +
|10,617
  +
|LociOiling
  +
|10,617
  +
|Beta Folders
  +
|
  +
|-
  +
|[https://fold.it/portal/node/2008203 1743: Revisiting Puzzle 73: Polycystein]
  +
|10/16/19
  +
|10,706
  +
|ZeroLeak7
  +
|10,709
  +
|ZeroLeak7
  +
|10,709
  +
|Go Science
  +
|
  +
|}
 
[[Category:Revisiting Puzzle]]
  
[[Category:Revisiting Puzzle]]

Revision as of 23:47, 19 March 2020

Irc 352715 1432470696 G1 Anthropic Dreams E1 Galaxie

Galaxie's PKD from puzzle 1089.

73: Polycystein is a revisiting puzzle, originally presented in 2008 as 73: Polycystein.

The protein in this puzzle is a glycoprotein which has been linked to polycystic kidney disease in humans. The puzzle protein is called a PKD domain. "PKD" stands for "polycystic kidney disease" and "domain" refers to a section of protein that is found as a component of other, larger proteins.

The puzzle consists of the following amino acid sequence: 

 
atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvtavlalgagsallgtdvqvea

This sequence is found in the following Protein Data Bank entry:

  • 1B4R (chain A, offset -7)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
73: Polycystein 08/21/08 9,782 zim57 9,836 gauchomurphy 9,821 Another Hour Another Point
770: Revisiting Puzzle 73: Polycystein 09/04/13 10,099 Alistair69 10,114 nicobul 10,114 L'Alliance Francophone
1089: Revisiting Puzzle 73: Polycystein 05/25/15 8,738 mirp 8,742 Galaxie 8,742 Anthropic Dreams
1292: Revisiting Puzzle 73: Polycystein 10/12/16 9,393 retiredmichael 9,396 smilingone 9,396 Beta Folders
1556: Revisiting Puzzle 73: Polycystein 08/08/18 10,614 reefyrob 10,617 LociOiling 10,617 Beta Folders
1743: Revisiting Puzzle 73: Polycystein 10/16/19 10,706 ZeroLeak7 10,709 ZeroLeak7 10,709 Go Science
Community content is available under CC-BY-SA unless otherwise noted.