Changes: Revisiting puzzle/73: Polycystein

Revision as of 05:32, 2 July 2019

Irc 352715 1432470696 G1 Anthropic Dreams E1 Galaxie — Galaxie's PKD from puzzle 1089.

73: Polycystein is a revisiting puzzle, originally presented in 2008 as 73: Polycystein.

The protein in this puzzle is a glycoprotein which has been linked to polycystic kidney disease in humans. The puzzle protein is called a PKD domain. "PKD" stands for "polycystic kidney disease" and "domain" refers to a section of protein that is found as a component of other, larger proteins.

The puzzle consists of the following amino acid sequence:

 
atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvtavlalgagsallgtdvqvea

This sequence is found in the following Protein Data Bank entry:

1B4R (chain A, offset -7)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

@@ Line 1: / Line 1: @@
 [[File:Irc 352715 1432470696 G1 Anthropic Dreams E1 Galaxie.png|thumb|400px|Galaxie's PKD from [[Puzzle 1089|puzzle 1089]].]]
-[[Revisiting_puzzle/Polycystein|Polycystein]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented in 2008 as [https://fold.it/portal/node/380771 73: Polycystein].
+[[Revisiting_puzzle/73: Polycystein|73: Polycystein]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented in 2008 as [https://fold.it/portal/node/380771 73: Polycystein].
 The protein in this puzzle is a [[wikipedia:Glycoprotein|glycoprotein]] which has been linked to polycystic kidney disease in humans. The puzzle protein is called a [[wikipedia:PKD_domain|PKD domain]]. "PKD" stands for "polycystic kidney disease" and "domain" refers to a section of protein that is found as a component of other, larger proteins.
-The puzzle has 80 segments with the sequence:
+The puzzle consists of the following amino acid sequence:
 <pre>