Editing Revisiting puzzle/73: Polycystein

[[File:Irc 352715 1432470696 G1 Anthropic Dreams E1 Galaxie.png|thumb|400px|Galaxie's PKD from [[Puzzle 1089|puzzle 1089]].]]
[[Revisiting_puzzle/73: Polycystein|73: Polycystein]] is a [[Revisiting puzzle|revisiting puzzle]], originally presented in 2008 as [https://fold.it/portal/node/380771 73: Polycystein].

The protein in this puzzle is a [[wikipedia:Glycoprotein|glycoprotein]] which has been linked to polycystic kidney disease in humans. The puzzle protein is called a [[wikipedia:PKD_domain|PKD domain]]. "PKD" stands for "polycystic kidney disease" and "domain" refers to a section of protein that is found as a component of other, larger proteins.

The puzzle has 80 segments with the sequence:

<pre> 
atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvtavlalgagsallgtdvqvea
</pre>

This sequence is found in the following [[PDB|Protein Data Bank]] entry:
*[https://www.rcsb.org/structure/1b4r 1B4R] (chain A, offset -7)

This puzzle does not have any [[Disulfide Bridge|disulfide bridges]].  

This puzzle does not have any [[Ligand|ligands]].

This puzzle has a single [[Chain|chain]].

See players' solutions from previous visits to this puzzle:
*[[Puzzle 770]]
*[[Puzzle 1089]]
*[[Puzzle 1556]]
*[[Puzzle 1743]]
*[[Puzzle 2283]]
Complete series of revisits with top scores: 
{| class="wikitable"
|-
!puzzle
!closed
!top solo score
!top solo
!top evo score
!top evo
!top group score
!top group
!comments
|-
|[https://fold.it/portal/node/380771 73: Polycystein]
|08/21/08
|9,782
|zim57
|9,836
|gauchomurphy
|9,821
|Another Hour Another Point
|
|-
|[https://fold.it/portal/node/995838 770: Revisiting Puzzle 73: Polycystein]
|09/04/13
|10,099
|Alistair69
|10,114
|nicobul
|10,114
|L'Alliance Francophone
|
|-
|[https://fold.it/portal/node/2000728 1089: Revisiting Puzzle 73: Polycystein]
|05/25/15
|8,738
|mirp
|8,742
|Galaxie
|8,742
|Anthropic Dreams
|
|-
|[https://fold.it/portal/node/2002906 1292: Revisiting Puzzle 73: Polycystein]
|10/12/16
|9,393
|retiredmichael
|9,396
|smilingone
|9,396
|Beta Folders
|
|-
|[https://fold.it/portal/node/2005546 1556: Revisiting Puzzle 73: Polycystein]
|08/08/18
|10,614
|reefyrob
|10,617
|LociOiling
|10,617
|Beta Folders
|
|-
|[https://fold.it/portal/node/2008203 1743: Revisiting Puzzle 73: Polycystein]
|10/16/19
|10,706
|ZeroLeak7
|10,709
|ZeroLeak7
|10,709
|Go Science
|
|-
|[https://fold.it/portal/node/2008203 2025: Revisiting Puzzle 73: Polycystein]
|07/29/21
|10,752
|mirp
|10,751
|toshiue
|10,752
|Go Science
|
|-
|[https://fold.it/portal/node/2008203 2025: Revisiting Puzzle 73: Polycystein]
|07/29/21
|10,752
|mirp
|10,751
|toshiue
|10,752
|Go Science
|
|-
|[https://fold.it/puzzles/2013597 2283: Revisiting Puzzle 73: Polycystein]
|10,695
|LociOiling
|10,699
|Galaxie
|10,699
|Anthropic Dreams
|
|}
[[Category:Revisiting Puzzle]]
[[Category:Revisiting Puzzle 73: Polycystein]]