FANDOM


Irc 352715 1432470696 G1 Anthropic Dreams E1 Galaxie

Galaxie's PKD from puzzle 1089.

73: Polycystein is a revisiting puzzle, originally presented in 2008 as 73: Polycystein.

The protein in this puzzle is a glycoprotein which has been linked to polycystic kidney disease in humans. The puzzle protein is called a PKD domain. "PKD" stands for "polycystic kidney disease" and "domain" refers to a section of protein that is found as a component of other, larger proteins.

The puzzle consists of the following amino acid sequence:

 
atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvtavlalgagsallgtdvqvea

This sequence is found in the following Protein Data Bank entry:

  • 1B4R (chain A, offset -7)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
73: Polycystein 08/21/08 9,782 zim57 9,836 gauchomurphy 9,821 Another Hour Another Point
770: Revisiting Puzzle 73: Polycystein 09/04/13 10,099 Alistair69 10,114 nicobul 10,114 L'Alliance Francophone
1089: Revisiting Puzzle 73: Polycystein 05/25/15 8,738 mirp 8,742 Galaxie 8,742 Anthropic Dreams
1292: Revisiting Puzzle 73: Polycystein 10/12/16 9,393 retiredmichael 9,396 smilingone 9,396 Beta Folders
1556: Revisiting Puzzle 73: Polycystein 08/08/18 10,614 reefyrob 10,617 LociOiling 10,617 Beta Folders
1743: Revisiting Puzzle 73: Polycystein 10/16/19 10,706 ZeroLeak7 10,709 ZeroLeak7 10,709 Go Science
Community content is available under CC-BY-SA unless otherwise noted.