FANDOM


Irc 352715 1432470696 G1 Anthropic Dreams E1 Galaxie

Galaxie's PKD from puzzle 1089.

73: Polycystein is a revisiting puzzle, originally presented in 2008 as 73: Polycystein.

The protein in this puzzle is a glycoprotein which has been linked to polycystic kidney disease in humans. The puzzle protein is called a PKD domain. "PKD" stands for "polycystic kidney disease" and "domain" refers to a section of protein that is found as a component of other, larger proteins.

The puzzle consists of the following amino acid sequence:

 
atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvtavlalgagsallgtdvqvea

This sequence is found in the following Protein Data Bank entry:

  • 1B4R (chain A, offset -7)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.