Foldit Wiki
Advertisement

LociOiling's crystallin from puzzle 1083.

71: Crystallin is a revisiting puzzle, originally presented in 2008 as Puzzle 71: Crystallin.

Crystallin is a protein found in the lens and cornea of the eye.

The puzzle has 86 segments with the sequence:

 
mykiqifekgdfngqmhettedcpsimeqfhmrevhsckvlegawifyelpnyrgrqylldkkeyrkpvdwgaaspavqsfrrive

This sequence is found in the following Protein Data Bank entry:

  • 1A7H (chains A and b, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
71: Crystallin 08/15/08 10,471 feet1st 10,540 jandersonlee 10,540 Void Crushers
766: Revisiting Puzzle 71: Crystallin 08/28/13 10,586 wisky 10,584 gloverd 10,586 Clear The Way
1083: Revisiting Puzzle 71: Crystallin 05/09/15 9,304 Vredeman 9,305 LociOiling 9,305 Beta Folders
1284: Revisiting Puzzle 71: Crystallin 09/21/16 9,589 reefyrob 9,587 smilingone 9,589 Beta Folders
1287: Revisiting Puzzle 71 with Density: Crystallin 09/28/16 13,776 bertro 13,776 LociOiling 13,775 Beta Folders
1539: Revisiting Puzzle 71: Crystallin 07/02/18 11,221 Waya 11,216 Galaxie 11,216 Anthropic Dreams
1735: Revisiting Puzzle 71: Crystallin 09/30/19 11,254 Galaxie 11,265 Galaxie 11,265 Anthropic Dreams
2019: Revisiting Puzzle 71: Crystallin 07/22/21 11,263 grogar7 11,291 Galaxie 11,291 Anthropic Dreams
Advertisement