FANDOM


Irc 447652 1473878807 S5 Bruno Kestemont

Bruno Kestemont's histone from puzzle 1281.

70: Nucleosome Protein is a revisiting puzzle, originally presented in 2008 as Puzzle 70: Nucleosome Protein.

This protein is a histone, and has been studied extensively. Histones are responsible for keeping DNA organized.

The puzzle has 98 segments with the sequence:

 phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
4XZQ

PDB 4XZQ shows the Puzzle 70 protein in complex structure that includes 7 other protein chains and 2 DNA chains in a double helix. The double helix in turn spirals around the protein complex.

This sequence is found in the following Protein Data Bank entries:

  • 1AOI (chains A and E, offset 18)
  • 1F66 (chains A and E, offset 38)
  • 1KX3 (chains A and E, offset 37)
  • 1KX4 (chains A and E, offset 37)
  • 1KX5 (chains A and E, offset 37)
  • 1M18 (chains A and E, offset 37)
  • 1M19 (chains A and E, offset 37)
  • 1M1A (chains A and E, offset 37)
  • 1P3B (chains A and E, offset 37)
  • 1P3F (chains A and E, offset 37)
  • 1P3G (chains A and E, offset 37)
  • 1P3I (chains A and E, offset 37)
  • 1P3O (chains A and E, offset 37)
  • 1P3P (chains A and E, offset 37)
  • 1S32 (chains A and E, offset 37)
  • 1ZBB (chains A and E, offset 37)
  • 2FJ7 (chains A and E, offset 37)
  • 2NZD (chains A and E, offset 37)
  • 3B6F (chains A and E, offset 37)
  • 3B6G (chains A and E, offset 37)
  • 3C1B (chains A and E, offset 37)
  • 3KUY (chains A and E, offset 37)
  • 3LEL (chains A, E, K, and O, offset 38)
  • 3LJA (chains A and E, offset 37)
  • 3LZ0 (chains A and E, offset 37)
  • 3LZ1 (chains A and E, offset 37)
  • 3MGP (chains A and E, offset 37)
  • 3MGQ (chains A and E, offset 37)
  • 3MGR (chains A and E, offset 37)
  • 3MGS (chains A and E, offset 37)
  • 3MNN (chains A and E, offset 37)
  • 3MVD (chains A and E, offset 37)
  • 3O62 (chains A and E, offset 37)
  • 3REH (chains A and E, offset 37)
  • 3REI (chains A and E, offset 37)
  • 3REJ (chains A and E, offset 37)
  • 3REK (chains A and E, offset 37)
  • 3REL (chains A and E, offset 37)
  • 3TU4 (chains A and E, offset 37)
  • 3UT9 (chains A and E, offset 37)
  • 3UTA (chains A and E, offset 37)
  • 3UTB (chains A and E, offset 37)
  • 4J8U (chains A and E, offset 37)
  • 4J8V (chains A and E, offset 37)
  • 4J8W (chains A and E, offset 37)
  • 4J8X (chains A and E, offset 37)
  • 4R8P (chains A and E, offset 37)
  • 4WU8 (chains A and E, offset 37)
  • 4WU9 (chains A and E, offset 37)
  • 4XUJ (chains A and E, offset 37)
  • 4XZQ (chains A and E, offset 0)
  • 4YS3 (chains A and E, offset 0)
  • 4Z66 (chains A and E, offset 0)
  • 4ZUX (chains A, E, K, and O, offset 38)
  • 5CP6 (chains A and E, offset 37)
  • 5DNM (chains A and E, offset 37)
  • 5DNN (chains A and E, offset 37)
  • 5E5A (chains A and E, offset 38)
  • 5HQ2 (chain A, offset 37)
  • 5NL0 (chains A, E, and K, offset 37)
  • 5O9G (chains A and E, offset 38)
  • 5OXV (chains A, E, K, and O, offset 37)
  • 5OY7 (chains A, C, E, I, M, Q, U, and Y, offset 37)
  • 5XF6 (chains A and E, offset 37)
  • 6ESF (chains A and E, offset 37)
  • 6ESG (chains A and E, offset 37)
  • 6ESH (chains A and E, offset 37)
  • 6ESI (chains A and E, offset 37)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
70: Nucleosome Protein 08/05/08 10,149 scrappyjoe 10,167 jakubo 10,167 Red Hat Club
761: Revisiting Puzzle 70: Nucleosome 08/21/13 10,035 auntdeen 10,347 Galaxie 10,347 Anthropic Dreams
1080: Revisiting Puzzle 70: Nucleosome Protein 04/25/15 9,046 wisky 9,059 Galaxie 9,059 Anthropic Dreams
1281: Revisiting Puzzle 70: Nucleosome Protein 09/14/16 9,548 Vredeman 9,561 Galaxie 9,561 Anthropic Dreams
1535: Revisiting Puzzle 70: Nucleosome Protein 06/25/18 10,860 Bruno Kestemont 10,861 Bruno Kestemont 10,861 Go Science
1731: Revisiting Puzzle 70: Nucleosome Protein 09/23/19 10,893 dcrwheeler 10,878 silentgene 10,892 Go Science
Community content is available under CC-BY-SA unless otherwise noted.