BitSpawn's puzzle 69 scorpion toxin from puzzle 1077.
69:Scorpion Toxin is a revisiting puzzle, originally presented as Puzzle 69: Scorpion Toxin in 2008.
For other revisiting puzzles involving scorpion toxins, see Revisiting puzzle/Scorpion toxin.
The puzzle protein is a neurotoxin from Hottentotta judaicus, a species of scorpion identified in 1872. This scorpion is much less toxic to humans than the puzzle 55 scorpion.
The puzzle protein has 74 segments with the sequence:
mkkngypldrngkttecsgvnaiaphycnsectkvyyaesgyccwgacycfgleddkpigpmkditkkycdvqi
This sequence is found in these Protein Data Bank entries:
The puzzleprotein can have four disulfide bridges, identified in 1BCG as 16-42, 27-47, 31-49, and 43-69. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
17,43 28,48 32,50 44,70
This puzzle protein does not have any ligands.
This puzzle protein has a single chain.
See players' solutions from previous visits to puzzle 69: