FANDOM


Irc 190318 1429951864 S3 BitSpawn

BitSpawn's puzzle 69 scorpion toxin from puzzle 1077.

69:Scorpion Toxin is a revisiting puzzle, originally presented as Puzzle 69: Scorpion Toxin in 2008.

For other revisiting puzzles involving scorpion toxins, see Revisiting puzzle/Scorpion toxin.

The puzzle protein is a neurotoxin from Hottentotta judaicus, a species of scorpion identified in 1872. This scorpion is much less toxic to humans than the puzzle 55 scorpion.

The puzzle protein has 74 segments with the sequence:

mkkngypldrngkttecsgvnaiaphycnsectkvyyaesgyccwgacycfgleddkpigpmkditkkycdvqi

This sequence is found in these Protein Data Bank entries:

  • 1BCG (chain A, offset 0)
  • 4KYP (chain A, B, C, and D, offset 1)

The puzzleprotein can have four disulfide bridges, identified in 1BCG as 16-42, 27-47, 31-49, and 43-69. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

17,43 28,48 32,50 44,70

This puzzle protein does not have any ligands.

This puzzle protein has a single chain.

See players' solutions from previous visits to puzzle 69:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
69: Scorpion Toxin 08/05/08 9,394 krogmonster 9,380 dejerpha 9,380 Richard Dawkins Foundation
758: Revisiting Puzzle 69: Scorpion Toxin 08/07/13 9,628 wisky 9,618 Hanto_FZ140E_4G 9,628 Clear The Way
762: Quick Revisiting of Puzzle 69: Scorpion 08/14/13 10,017 spmm 10,019 spdenne 10,019 Void Crushers
1077: Revisiting Puzzle 69: Scorpion Toxin 04/17/15 9,779 dembones 9,792 LociOiling 9,792 Beta Folders
1278: Revisiting Puzzle 69: Scorpion Toxin 09/07/16 10,044 Mike Lewis 10,045 ManVsYard 10,045 Gargleblasters
1532: Revisiting Puzzle 69: Scorpion Toxin 06/18/18 11,156 Glen B 10,884 LociOiling 10,884 Beta Folders
1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin 07/16/18 10,872 bertro 10,888 LociOiling 10,888 Beta Folders
1727: Revisiting Puzzle 69: Scorpion Toxin 09/16/19 10,991 fiendish_ghoul 10,992 jausmh 10,992 Marvin's Bunch
Community content is available under CC-BY-SA unless otherwise noted.