
KarenCH's calbindin from puzzle 1047.
68: Bos taurus is a revisiting puzzle, originally presented in 2008 as Puzzle 68: Bos taurus.
Bos taurus is Latin for "cow". The protein in this puzzle comes from cows. It's a type of calbindin, a calcium-binding protein.
The puzzle has 75 segments with the sequence:
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdgevsfeefqvlvkkisq
This sequence is found in the following Protein Data Bank entries:
- 1BLG (chain A, offset 0)
- 1CDN (chain A, offset 1)
- 1CLB (chain A, offset 1)
- 2BCA (chain A, offset 1)
- 2BCB (chain A, offset 0)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
68: Bos taurus | 07/26/08 | 9,851 | dejerpha | 9,131 | beenen34 | 9,851 | Richard Dawkins Foundation | |
754: Revisiting Puzzle 68: Bos taurus | 07/31/13 | 10,032 | nemo7731 | 10,034 | dembones | 10,034 | Contenders | |
1074: Revisiting Puzzle 68: Bos Taurus | 04/10/15 | 9,335 | gitwut | 9,340 | egran48 | 9,340 | Go Science | |
1276: Revisiting Puzzle 68: Bos Taurus | 08/31/16 | 9,453 | KarenCH | 9,458 | Galaxie | 9,458 | Anthropic Dreams | |
1529: Revisiting Puzzle 68: Bos Taurus | 06/11/18 | 10,749 | bertro | 10,751 | Galaxie | 10,71 | Anthropic Dreams | |
1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus | 07/19/18 | 10,626 | ZeroLeak7 | 10,597 | sciencewalker | 10,626 | Go Science | |
1724: Revisiting Puzzle 68: Bos Taurus | 09/09/18 | 10,728 | O Seki To | 10,728 | O Seki To | 10,728 | Hun-Magyar Csapat |
Community content is available under CC-BY-SA unless otherwise noted.