KarenCH's calbindin from puzzle 1047.

68: Bos taurus is a revisiting puzzle, originally presented in 2008 as Puzzle 68: Bos taurus.

Bos taurus is Latin for "cow". The protein in this puzzle comes from cows. It's a type of calbindin, a calcium-binding protein.

The puzzle has 75 segments with the sequence:

kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdgevsfeefqvlvkkisq

This sequence is found in the following Protein Data Bank entries:

  • 1BLG (chain A, offset 0)
  • 1CDN (chain A, offset 1)
  • 1CLB (chain A, offset 1)
  • 2BCA (chain A, offset 1)
  • 2BCB (chain A, offset 0)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
68: Bos taurus 07/26/08 9,851 dejerpha 9,131 beenen34 9,851 Richard Dawkins Foundation
754: Revisiting Puzzle 68: Bos taurus 07/31/13 10,032 nemo7731 10,034 dembones 10,034 Contenders
1074: Revisiting Puzzle 68: Bos Taurus 04/10/15 9,335 gitwut 9,340 egran48 9,340 Go Science
1276: Revisiting Puzzle 68: Bos Taurus 08/31/16 9,453 KarenCH 9,458 Galaxie 9,458 Anthropic Dreams
1529: Revisiting Puzzle 68: Bos Taurus 06/11/18 10,749 bertro 10,751 Galaxie 10,71 Anthropic Dreams
1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus 07/19/18 10,626 ZeroLeak7 10,597 sciencewalker 10,626 Go Science
1724: Revisiting Puzzle 68: Bos Taurus 09/09/18 10,728 O Seki To 10,728 O Seki To 10,728 Hun-Magyar Csapat
Community content is available under CC-BY-SA unless otherwise noted.