Bruno Kestemont's cytochrome from puzzle 1069.
66: Cytochrome is a revisiting puzzle, originally presented in 2009 as Puzzle 66: Cytochrome.
Cytochromes usually contain an iron-based ligand known as heme. The ligand is not present in the Foldit puzzle. Cytochromes are involved in key redox reactions, including those which generate ATP.
The puzzle has 71 segments with the sequence:
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaeaeavaawlaekk
This sequence is found in several Protein Data Bank entries:
- 1N9C (chain A, offset 0)
- 1K3H (chain A, offset 0)
- 1K3G (chain A, offset 0)
- 1C75 (chain A, offset 0)
- 1B7V (chain A, offset 0)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
| puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
|---|---|---|---|---|---|---|---|---|
| 66: Cytochrome | 07/24/08 | 9,680 | Steven Pletsch | 9,680 | Another Hour Another Point | |||
| 747: Revisiting Puzzle 66: Cytochrome | 07/24/13 | 9,724 | dembones | 9,724 | BletchleyPark | 9,724 | Contenders | |
| 1069: Revisiting Puzzle 66: Cytochrome | 04/04/15 | 8,843 | Bruno Kestemont | 8,843 | Paulo Roque | 8,843 | Go Science | |
| 1270: Revisiting Puzzle 66: Cytochrome | 08/10/16 | 9,212 | reefyrob | 9,198 | smilingone | 9,198 | Beta Folders | |
| 1523: Revisiting Puzzle 66: Cytochrome | 05/28/18 | 10,279 | bertro | 10,277 | LociOiling | 10,279 | Beta Folders | |
| 1716: Revisiting Puzzle 66: Cytochrome | 08/26/19 | 10,361 | Rock On | 10,237 | Bruno Kestemont | 10,238 | Go Science | |
| 2001: Revisiting Puzzle 66: Cytochrome | 06/10/21 | 10,253 | sallallami | 10,247 | LociOiling | 10,247 | Beta Folders | |
| 2260: Revisiting Puzzle 66: Cytochrome | 02/09/23 | 10,292 | dcrwheeler | 10,287 | toshiue | 10,287 | Go Science |