FANDOM


Irc 455069 1427462138 G1 Beta Folders E4 retiredmichael

retiredmichael's thioredoxin from puzzle 1066.

64: Thioredoxin is a revisiting puzzle, originally presented in 2009 as Puzzle 64: Thioredoxin.

Thioredoxins are anti-oxidant proteins that act as enzymes. Thioredoxin is involved in the reduction of insulin and other important biological processes.

The puzzle has 105 segments with the sequence:

 mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvndcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

This sequence is found in the Protein Data Bank as 1AIU. (The sequence is at offset 0 of chain A in 1AIU.)

There's also a close match at 5DQY. 5DQY and 1AIU differ by only one segment. At segment 60, 1AIU has asparagine, where 5DQY has aspartate.

5DQY also has two disulfide bridges, 32-35 and 62-69. The bridges are not identified in PDB 1AIU, although the same segments are present. 5DQY also lists a third bridge as 73-73, which seems to be an error.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
64: Thioredoxin 07/19/08 10,869 sirenbrian 10,869 Another Hour Another Point
739: Revisiting Puzzle 64: Thioredoxin 07/10/13 10,816 wisky 10,820 dembones 10,820 Contenders
1066: Revisiting Puzzle 64: Thioredoxin 03/27/15 9,643 retiredmichael 9,642 reefyrob 9,643 Beta Folders
1267: Revisiting Puzzle 64: Thioredoxin 08/10/16 9,988 bertro 10,003 retiredmichael 10,003 Beta Folders
1520: Revisiting Puzzle 64: Thioredoxin 05/21/18 11,783 Timo van der Laan 11,803 Neil9 11,803 Void Crushers
1712: Revisiting Puzzle 64: Thioredoxin 08/19/19 11,764 Bruno Kestemont 11,760 silent gene 11,764 Go Science
Community content is available under CC-BY-SA unless otherwise noted.