watch 01:25
Jurassic World: Dominion Dominates Fandom Wikis - The Loop
Do you like this video?
Play Sound

KarenCH's spinach protein from puzzle 1264.
63: Spinach Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 63: Spinach Protein.
As the name suggests, this protein is from spinach, Spinacia oleracea to be specific. It's an example of a ferredoxin, a type of iron–sulfur protein that can change the oxidation state of iron.
The puzzle has 97 segments with the sequence:
aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqddqsfldddqidegwvltcaaypvsdvtiethkkeelta
This sequence is found in the Protein Data Bank as 1A70. (The sequence is at offset 0 of chain A in 1A70.)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
63: Spinach Protein | 07/06/08 | 10,581 | sirenbrian | 10,581 | Another Hour Another Point | |||
736: Revisiting Puzzle 63: Spinach Protein | 06/25/13 | 10,476 | Aubade00 | 10,513 | utaca | 10,513 | Void Crushers | |
1063: Revisiting Puzzle 63: Spinach Protein | 03/19/15 | 9,320 | KarenCH | 9,333 | gloverd | 9,333 | Go Science | |
1264: Revisiting Puzzle 63: Spinach Protein | 08/03/16 | 9,367 | KarenCH | 9,646 | Galaxie | 9,646 | Anthropic Dreams | |
1517: Revisiting Puzzle 63: Spinach Protein | 05/14/18 | 11,251 | phi16 | 11,252 | Galaxie | 11,252 | Anthropic Dreams | |
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein | 07/20/18 | 11,031 | robgee | 11,023 | Galaxie | 11,031 | Anthropic Dreams | |
1709: Revisiting Puzzle 63: Spinach Protein | 08/12/19 | 11,186 | retiredmichael | 11,200 | LociOiling | 11,200 | Beta Folders | |
1987: Revisiting Puzzle 63: Spinach Protein | 05/06/21 | 11,218 | LociOiling | 11,213 | LociOiling | 11,218 | Beta Folders |