KarenCH's spinach protein from puzzle 1264.
63: Spinach Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 63: Spinach Protein.
As the name suggests, this protein is from spinach, Spinacia oleracea to be specific. It's an example of a ferredoxin, a type of iron–sulfur protein that can change the oxidation state of iron.
The puzzle has 97 segments with the sequence:
aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqddqsfldddqidegwvltcaaypvsdvtiethkkeelta
This sequence is found in the Protein Data Bank as 1A70. (The sequence is at offset 0 of chain A in 1A70.)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Community content is available under CC-BY-SA
unless otherwise noted.
