Revisiting puzzle/63: Spinach Protein

KarenCH's spinach protein from puzzle 1264.

63: Spinach Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 63: Spinach Protein.

As the name suggests, this protein is from spinach, Spinacia oleracea to be specific. It's an example of a ferredoxin, a type of iron–sulfur protein that can change the oxidation state of iron.

The puzzle has 97 segments with the sequence:

 aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqddqsfldddqidegwvltcaaypvsdvtiethkkeelta

This sequence is found in the Protein Data Bank as 1A70. (The sequence is at offset 0 of chain A in 1A70.)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

• Puzzle 736
• Puzzle 1063
• Puzzle 1264
• Puzzle 1517
• Puzzle 1709
• Puzzle 1987

Complete series of revisits with top scores:

puzzle	closed	top solo score	top solo	top evo score	top evo	top group score	top group	comments
63: Spinach Protein	07/06/08	10,581	sirenbrian			10,581	Another Hour Another Point
736: Revisiting Puzzle 63: Spinach Protein	06/25/13	10,476	Aubade00	10,513	utaca	10,513	Void Crushers
1063: Revisiting Puzzle 63: Spinach Protein	03/19/15	9,320	KarenCH	9,333	gloverd	9,333	Go Science
1264: Revisiting Puzzle 63: Spinach Protein	08/03/16	9,367	KarenCH	9,646	Galaxie	9,646	Anthropic Dreams
1517: Revisiting Puzzle 63: Spinach Protein	05/14/18	11,251	phi16	11,252	Galaxie	11,252	Anthropic Dreams
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein	07/20/18	11,031	robgee	11,023	Galaxie	11,031	Anthropic Dreams
1709: Revisiting Puzzle 63: Spinach Protein	08/12/19	11,186	retiredmichael	11,200	LociOiling	11,200	Beta Folders
1987: Revisiting Puzzle 63: Spinach Protein	05/06/21	11,218	LociOiling	11,213	LociOiling	11,218	Beta Folders