KarenCH's spinach protein from puzzle 1264.

63: Spinach Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 63: Spinach Protein.

As the name suggests, this protein is from spinach, Spinacia oleracea to be specific. It's an example of a ferredoxin, a type of iron–sulfur protein that can change the oxidation state of iron.

The puzzle has 97 segments with the sequence:

 aaykvtlvtptgnvefqcpddvyildaaeeegidlpyscragscsscagklktgslnqddqsfldddqidegwvltcaaypvsdvtiethkkeelta

This sequence is found in the Protein Data Bank as 1A70. (The sequence is at offset 0 of chain A in 1A70.)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
63: Spinach Protein 07/06/08 10,581 sirenbrian 10,581 Another Hour Another Point
736: Revisiting Puzzle 63: Spinach Protein 06/25/13 10,476 Aubade00 10,513 utaca 10,513 Void Crushers
1063: Revisiting Puzzle 63: Spinach Protein 03/19/15 9,320 KarenCH 9,333 gloverd 9,333 Go Science
1264: Revisiting Puzzle 63: Spinach Protein 08/03/16 9,367 KarenCH 9,646 Galaxie 9,646 Anthropic Dreams
1517: Revisiting Puzzle 63: Spinach Protein 05/14/18 11,251 phi16 11,252 Galaxie 11,252 Anthropic Dreams
1547: Sketchbook Puzzle - Revisiting Puzzle 63: Spinach Protein 07/20/18 11,031 robgee 11,023 Galaxie 11,031 Anthropic Dreams
1709: Revisiting Puzzle 63: Spinach Protein 08/12/19 11,186 retiredmichael 11,200 LociOiling 11,200 Beta Folders
Community content is available under CC-BY-SA unless otherwise noted.