FANDOM


Irc 447652 1425577226 G2 Go Science E2 Bruno Kestemont

Bruno Kestemont's Top7 from puzzle 1056.

61: Designer Protein Top7 is a revisiting puzzle, originally presented in 2008 as Puzzle 61: Designer Protein Top7.

Top7 is a protein designed by scientists at the Baker Lab at the University of Washington, and published in 2003. It has a "novel fold", meaning that no natural proteins are folded in a similar pattern.

This protein was the PDB's Molecule of the Month for October 2005

The puzzle has 92 segments with the sequence:

diqvqvniddngknfdytytvtteselqkvlnelmdyikkqgakrvrisitartkkeaekfaailikvfaelgyndinvtfdgdtvtvegql

This sequence is found in the Protein Data Bank as 1QYS.

The sequence is at offset 2 of chain A in 1QYS, meaning segment 1 of the protein in Foldit is residue 3 of 1QYS. The model for 1QYS actually starts with residue 3 and runs to residue 94. The sequence for 1QYS shows 106 residues, but only residues 3 to 94 are present in the model.

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle is a single chain.

See players' solutions from previous visits to this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.