FANDOM


Irc 447652 1425577226 G2 Go Science E2 Bruno Kestemont

Bruno Kestemont's Top7 from puzzle 1056.

61: Designer Protein Top7 is a revisiting puzzle, originally presented in 2008 as Puzzle 61: Designer Protein Top7.

Top7 is a protein designed by scientists at the Baker Lab at the University of Washington, and published in 2003. It has a "novel fold", meaning that no natural proteins are folded in a similar pattern.

This protein was the PDB's Molecule of the Month for October 2005

The puzzle has 92 segments with the sequence:

diqvqvniddngknfdytytvtteselqkvlnelmdyikkqgakrvrisitartkkeaekfaailikvfaelgyndinvtfdgdtvtvegql

This sequence is found in the Protein Data Bank as 1QYS.

The sequence is at offset 2 of chain A in 1QYS, meaning segment 1 of the protein in Foldit is residue 3 of 1QYS. The model for 1QYS actually starts with residue 3 and runs to residue 94. The sequence for 1QYS shows 106 residues, but only residues 3 to 94 are present in the model.

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle is a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
61: Designer Protein Top7 06/12/08 10,572 sirenbrian 10,572 Another Hour Another Point
710: 5-year-anniversary puzzle: 2008 05/14/13 10,982 wisky 10,982 Hanto_FZ140E_4G 10,982 Clear The Way start year 2003?!?
1056: Revisiting Puzzle 61: Designer Protein Top7 02/26/15 9,840 LociOiling 9,845 retiredmichael 9,845 Beta Folders
1259: Revisiting Puzzle 61: Designer Protein Top7 07/20/16 10,064 LociOiling 10,066 Bletchley Park 10,066 Contenders
1512: Revisiting Puzzle 61: Designer Protein Top7 04/30/18 11,691 ZeroLeak7 11,700 Galaxie 11,700 Anthropic Dreams
1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7 07/09/18 11,651 Timo van der Laan 11,659 LociOiling 11,659 Beta Folders
1702: Revisiting Puzzle 61: Designer Protein Top7 07/29/19 11,733 johnmitch 11,749 ManVsYard 11,749 Gargleblasters
Community content is available under CC-BY-SA unless otherwise noted.