FANDOM


Irc 426239 1372216329 S7 gitwut

Gitwut's beta barrel from puzzle 733b.

60: Beta Barrel is a revisiting puzzle, originally presented in 2008 as Puzzle 60: Beta Barrel.

As the "Beta" in the name suggests, the protein in this puzzle is composed mainly of sheets, forming a tube or "barrel", known as a beta barrel.

The puzzle has 132 segments with the sequence:

 afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidnvfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytyegveakrifkke

This sequence is found in the Protein Data Bank as 1DC9. (The sequence is at offset 0 of chain A in 1DC9.)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
60: Beta Barrel 06/12/08 11,433 ferzle 11,433 Another Hour Another Point
733b: Revisiting Puzzle 60: Beta Barrel 06/25/13 11,950 MurloW 11,957 Galaxie 11,957 Anthropic Dreams
1053: Revisiting Puzzle 60: Beta Barrel 02/26/15 10,269 retiredmichael 10,294 reefyrob 10,294 Beta Folders
1256: Revisiting Puzzle 60: Beta Barrel 07/13/16 10,466 Fetztastic 10,470 Bletchley Park 10,470 Contenders
1508: Revisiting Puzzle 60: Beta Barrel 04/18/18 12,655 LociOiling 12,707 reefyrob 12,707 Beta Folders
1699: Revisiting Puzzle 60: Beta Barrel 07/22/19 12,766 Galaxie 12,789 Galaxie 12,789 Anthropic Dreams
Community content is available under CC-BY-SA unless otherwise noted.