
Gitwut's beta barrel from puzzle 733b.
60: Beta Barrel is a revisiting puzzle, originally presented in 2008 as Puzzle 60: Beta Barrel.
As the "Beta" in the name suggests, the protein in this puzzle is composed mainly of sheets, forming a tube or "barrel", known as a beta barrel.
The puzzle has 132 segments with the sequence:
afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidnvfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytyegveakrifkke
This sequence is found in the Protein Data Bank as 1DC9. (The sequence is at offset 0 of chain A in 1DC9.)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
60: Beta Barrel | 06/12/08 | 11,433 | ferzle | 11,433 | Another Hour Another Point | |||
733b: Revisiting Puzzle 60: Beta Barrel | 06/25/13 | 11,950 | MurloW | 11,957 | Galaxie | 11,957 | Anthropic Dreams | |
1053: Revisiting Puzzle 60: Beta Barrel | 02/26/15 | 10,269 | retiredmichael | 10,294 | reefyrob | 10,294 | Beta Folders | |
1256: Revisiting Puzzle 60: Beta Barrel | 07/13/16 | 10,466 | Fetztastic | 10,470 | Bletchley Park | 10,470 | Contenders | |
1508: Revisiting Puzzle 60: Beta Barrel | 04/18/18 | 12,655 | LociOiling | 12,707 | reefyrob | 12,707 | Beta Folders | |
1699: Revisiting Puzzle 60: Beta Barrel | 07/22/19 | 12,766 | Galaxie | 12,789 | Galaxie | 12,789 | Anthropic Dreams | |
1975: Revisiting Puzzle 60: Beta Barrel | 04/08/21 | 12,819 | LociOiling | 12,808 | Angus | 12,819 | Beta Folders |