gloverd's T-cell receptor binding protein from puzzle 729.
59: TCR Binding Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 59: TCR Binding Protein.
The puzzle comments indicate this protein "binds to the cytoplasmic domain of the T-cell receptor", explaining the "TCR binding" in the name. The puzzle protein is a type of signaling protein that plays a role in regulating the immune system.
The puzzle has 62 segments with the sequence:
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdlyt
Protein Data Bank matches for this sequence:
- 1GYF (chain A, offset 0)
- 1L2Z (chain A, offset 0)
- 1SYx (chains B, D, F; offset -24)
- 4BWS (chains C, F; offset -9)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Community content is available under CC-BY-SA
unless otherwise noted.
