Revisiting puzzle/59: TCR Binding Protein

gloverd's T-cell receptor binding protein from puzzle 729.

59: TCR Binding Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 59: TCR Binding Protein.

The puzzle comments indicate this protein "binds to the cytoplasmic domain of the T-cell receptor", explaining the "TCR binding" in the name. The puzzle protein is a type of signaling protein that plays a role in regulating the immune system.

The puzzle has 62 segments with the sequence:

dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdlyt

Protein Data Bank matches for this sequence:

• 1GYF (chain A, offset 0)
• 1L2Z (chain A, offset 0)
• 1SYx (chains B, D, F; offset -24)
• 4BWS (chains C, F; offset -9)

This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

• Puzzle 729
• Puzzle 1050
• Puzzle 1253
• Puzzle 1506
• Puzzle 1696

Complete series of revisits with top scores:

puzzle	closed	top solo score	top solo	top evo score	top evo	top group score	top group	comments
59: TCR Binding Protein	06/12/08	9,409	sirenbrian			9,409	Another Hour Another Point
729: Revisiting Puzzle 59: TCR Binding Protein	06/29/13	9,471	dembones	9,506	gloverd	9,506	Go Science
1050: Revisiting Puzzle 59: TCR Binding Protein	02/19/15	8,898	BitSpawn	8,890	viosca	8,898	Anthropic Dreams
1253: Revisiting Puzzle 59: TCR Binding Protein	07/06/16	9,089	Fetztastic	9,090	Paulo Roque	9,090	Go Science
1506: Revisiting Puzzle 59: TCR Binding Protein	04/16/18	10,156	actiasluna	10,151	ManVsYard	10,156	Gargleblasters
1696: Revisiting Puzzle 59: TCR Binding Protein	07/15/19	10,136	grogar7	10,117	Galaxie	10,117	Anthropic Dreams