watch 01:36
We're Getting Mutants in the MCU - The Loop
Do you like this video?
Play Sound

gloverd's T-cell receptor binding protein from puzzle 729.
59: TCR Binding Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 59: TCR Binding Protein.
The puzzle comments indicate this protein "binds to the cytoplasmic domain of the T-cell receptor", explaining the "TCR binding" in the name. The puzzle protein is a type of signaling protein that plays a role in regulating the immune system.
The puzzle has 62 segments with the sequence:
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdlyt
Protein Data Bank matches for this sequence:
- 1GYF (chain A, offset 0)
- 1L2Z (chain A, offset 0)
- 1SYx (chains B, D, F; offset -24)
- 4BWS (chains C, F; offset -9)
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
59: TCR Binding Protein | 06/12/08 | 9,409 | sirenbrian | 9,409 | Another Hour Another Point | |||
729: Revisiting Puzzle 59: TCR Binding Protein | 06/29/13 | 9,471 | dembones | 9,506 | gloverd | 9,506 | Go Science | |
1050: Revisiting Puzzle 59: TCR Binding Protein | 02/19/15 | 8,898 | BitSpawn | 8,890 | viosca | 8,898 | Anthropic Dreams | |
1253: Revisiting Puzzle 59: TCR Binding Protein | 07/06/16 | 9,089 | Fetztastic | 9,090 | Paulo Roque | 9,090 | Go Science | |
1506: Revisiting Puzzle 59: TCR Binding Protein | 04/16/18 | 10,156 | actiasluna | 10,151 | ManVsYard | 10,156 | Gargleblasters | |
1696: Revisiting Puzzle 59: TCR Binding Protein | 07/15/19 | 10,136 | grogar7 | 10,117 | Galaxie | 10,117 | Anthropic Dreams |