FANDOM


Irc 466533 1371657570 E1 Go science Gloverd Paul

gloverd's T-cell receptor binding protein from puzzle 729.

59: TCR Binding Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 59: TCR Binding Protein.

The puzzle comments indicate this protein "binds to the cytoplasmic domain of the T-cell receptor", explaining the "TCR binding" in the name. The puzzle protein is a type of signaling protein that plays a role in regulating the immune system.

The puzzle has 62 segments with the sequence:

dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdlyt

Protein Data Bank matches for this sequence:

  • 1GYF (chain A, offset 0)
  • 1L2Z (chain A, offset 0)
  • 1SYx (chains B, D, F; offset -24)
  • 4BWS (chains C, F; offset -9)


This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Community content is available under CC-BY-SA unless otherwise noted.