Foldit Wiki
Advertisement

gloverd's T-cell receptor binding protein from puzzle 729.

59: TCR Binding Protein is a revisiting puzzle, originally presented in 2009 as Puzzle 59: TCR Binding Protein.

The puzzle comments indicate this protein "binds to the cytoplasmic domain of the T-cell receptor", explaining the "TCR binding" in the name. The puzzle protein is a type of signaling protein that plays a role in regulating the immune system.

The puzzle has 62 segments with the sequence:

dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdlyt

Protein Data Bank matches for this sequence:

  • 1GYF (chain A, offset 0)
  • 1L2Z (chain A, offset 0)
  • 1SYx (chains B, D, F; offset -24)
  • 4BWS (chains C, F; offset -9)


This puzzle does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
59: TCR Binding Protein 06/12/08 9,409 sirenbrian 9,409 Another Hour Another Point
729: Revisiting Puzzle 59: TCR Binding Protein 06/29/13 9,471 dembones 9,506 gloverd 9,506 Go Science
1050: Revisiting Puzzle 59: TCR Binding Protein 02/19/15 8,898 BitSpawn 8,890 viosca 8,898 Anthropic Dreams
1253: Revisiting Puzzle 59: TCR Binding Protein 07/06/16 9,089 Fetztastic 9,090 Paulo Roque 9,090 Go Science
1506: Revisiting Puzzle 59: TCR Binding Protein 04/16/18 10,156 actiasluna 10,151 ManVsYard 10,156 Gargleblasters
1696: Revisiting Puzzle 59: TCR Binding Protein 07/15/19 10,136 grogar7 10,117 Galaxie 10,117 Anthropic Dreams
Advertisement