Revisiting puzzle/57: Beta-Neurotoxin

retiredmichael's scorpion toxin from puzzle 1044.

57: Beta-Neurotoxin is a revisiting puzzle, originally presented in 2008 as Puzzle 57: Beta-Neurotoxin.

For other revisiting puzzles involving scorpion toxins, see Scorpion toxin.

This protein is a scorpion toxin (P01491). It is also considered a "knottin" after the complex, knot-like disulfide bridge architexture. Members of the family have a secondary structure consisting mainly of sheets. For other revisiting puzzles involving scorpion toxins, see Revisiting puzzle/Scorpion toxin.

The puzzle has 64 segments with the sequence:

kdgylvektgckktcyklgendfcnreckwkhiggsygycygfgcyceglpdstqtwplpnktc

This sequence is found in the following Protein Data Bank entry:

1B3C (chain A, offset 0)
2B3C (chain A, offset 0)

This puzzle can have four disulfide bridges. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed. The bridges are identified in 1B3C as 11-64, 15-40, 24-45, and 28-47.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

11,64 15,40 24,45 28,47

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle	closed	top solo score	top solo	top evo score	top evo	top group score	top group
57: Beta-Neurotoxin	05/28/08	8,867	MattSaffell			8,867	Another Hour Another Point
1044: Revisiting Puzzle 57: Beta-Neurotoxin	02/05/15	9,829	retiredmichael	9,826	Galaxie	9,829	Beta Folders
1247: Revisiting Puzzle 57: Beta-Neurotoxin	06/22/16	9,933	Aubade01	9,880	gitwut	9,880	Contenders
1498: Revisiting Puzzle 57: Beta-Neurotoxin	03/26/18	10,711	eusair	10,558	Blipperman	10,558	Gargleblasters
1690: Revisiting Puzzle 57: Beta-Neurotoxin	07/01/19	10,554	LociOiling	10,549	LociOiling	10,554	Beta Folders
1961: Revisiting Puzzle 57: Beta-Neurotoxin	02/25/21	10,566	Aubade01	10,623	fpc	10,623	Marvin's Bunch

Revisiting puzzle/57: Beta-Neurotoxin

Fan Feed