Foldit Wiki
Advertisement

retiredmichael's scorpion toxin from puzzle 1044.

57: Beta-Neurotoxin is a revisiting puzzle, originally presented in 2008 as Puzzle 57: Beta-Neurotoxin.

This protein is a scorpion toxin (P01491). It is also considered a "knottin" after the complex, knot-like disulfide bridge architexture. Members of the family have a secondary structure consisting mainly of sheets. For other revisiting puzzles involving scorpion toxins, see Revisiting puzzle/Scorpion toxin.

The puzzle has 64 segments with the sequence:

kdgylvektgckktcyklgendfcnreckwkhiggsygycygfgcyceglpdstqtwplpnktc

This sequence is found in the following Protein Data Bank entry:

  • 1B3C (chain A, offset 0)
  • 2B3C (chain A, offset 0)

This puzzle can have four disulfide bridges. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed. The bridges are identified in 1B3C as 11-64, 15-40, 24-45, and 28-47.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

11,64 15,40 24,45 28,47

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
57: Beta-Neurotoxin 05/28/08 8,867 MattSaffell 8,867 Another Hour Another Point
1044: Revisiting Puzzle 57: Beta-Neurotoxin 02/05/15 9,829 retiredmichael 9,826 Galaxie 9,829 Beta Folders
1247: Revisiting Puzzle 57: Beta-Neurotoxin 06/22/16 9,933 Aubade01 9,880 gitwut 9,880 Contenders
1498: Revisiting Puzzle 57: Beta-Neurotoxin 03/26/18 10,711 eusair 10,558 Blipperman 10,558 Gargleblasters
1690: Revisiting Puzzle 57: Beta-Neurotoxin 07/01/19 10,554 LociOiling 10,549 LociOiling 10,554 Beta Folders
1961: Revisiting Puzzle 57: Beta-Neurotoxin 02/25/21 10,566 Aubade01 10,623 fpc 10,623 Marvin's Bunch
Advertisement