retiredmichael's scorpion toxin from puzzle 1044.
57: Beta-Neurotoxin is a revisiting puzzle, originally presented in 2008 as Puzzle 57: Beta-Neurotoxin.
This protein is a scorpion toxin (P01491). It is also considered a "knottin" after the complex, knot-like disulfide bridge architexture. Members of the family have a secondary structure consisting mainly of sheets. For other revisiting puzzles involving scorpion toxins, see Revisiting puzzle/Scorpion toxin.
The puzzle has 64 segments with the sequence:
kdgylvektgckktcyklgendfcnreckwkhiggsygycygfgcyceglpdstqtwplpnktc
This sequence is found in the following Protein Data Bank entry:
This puzzle can have four disulfide bridges. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed. The bridges are identified in 1B3C as 11-64, 15-40, 24-45, and 28-47.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
11,64 15,40 24,45 28,47
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
