
retiredmichael's scorpion toxin from puzzle 1044.
57: Beta-Neurotoxin is a revisiting puzzle, originally presented in 2008 as Puzzle 57: Beta-Neurotoxin.
For other revisiting puzzles involving scorpion toxins, see Scorpion toxin.
This protein is a scorpion toxin (P01491). It is also considered a "knottin" after the complex, knot-like disulfide bridge architexture. Members of the family have a secondary structure consisting mainly of sheets. For other revisiting puzzles involving scorpion toxins, see Revisiting puzzle/Scorpion toxin.
The puzzle has 64 segments with the sequence:
kdgylvektgckktcyklgendfcnreckwkhiggsygycygfgcyceglpdstqtwplpnktc
This sequence is found in the following Protein Data Bank entry:
This puzzle can have four disulfide bridges. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed. The bridges are identified in 1B3C as 11-64, 15-40, 24-45, and 28-47.
The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:
11,64 15,40 24,45 28,47
This puzzle does not have any ligands.
This puzzle has a single chain.
See players' solutions from previous visits to this puzzle:
Complete series of revisits with top scores:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
57: Beta-Neurotoxin | 05/28/08 | 8,867 | MattSaffell | 8,867 | Another Hour Another Point | |||
1044: Revisiting Puzzle 57: Beta-Neurotoxin | 02/05/15 | 9,829 | retiredmichael | 9,826 | Galaxie | 9,829 | Beta Folders | |
1247: Revisiting Puzzle 57: Beta-Neurotoxin | 06/22/16 | 9,933 | Aubade01 | 9,880 | gitwut | 9,880 | Contenders | |
1498: Revisiting Puzzle 57: Beta-Neurotoxin | 03/26/18 | 10,711 | eusair | 10,558 | Blipperman | 10,558 | Gargleblasters | |
1690: Revisiting Puzzle 57: Beta-Neurotoxin | 07/01/19 | 10,554 | LociOiling | 10,549 | LociOiling | 10,554 | Beta Folders | |
1961: Revisiting Puzzle 57: Beta-Neurotoxin | 02/25/21 | 10,566 | Aubade01 | 10,623 | fpc | 10,623 | Marvin's Bunch |