Foldit Wiki
Advertisement

LociOiling's puzzle 55 scorpion toxin from puzzle 1495.

55: Scorpion Toxin is a revisiting puzzle, originally presented as Puzzle 55: Scorpion Toxin in 2008.

For other revisiting puzzles involving scorpion toxins, see Revisiting puzzle/Scorpion toxin.

The puzzle protein is a neurotoxin from Androctonus australis, one of the most toxic species of scorpion.

The puzzle protein has 64 segments with the sequence:

vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgpgrch

This sequence is found in these Protein Data Bank entries:

  • 1AHO (chain A, offset 0)
  • 1PTX (chain A, offset 0)
  • 4AEI (chains B and C, offset 0)

The puzzle protein can have four disulfide bridges, identified in 1AHO as 12-63, 16-36, 22-46, and 26-48. In recent visits to this puzzle, each bridge is awarded a bonus of 250 points.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridges in this format:

16,36 12,63 22,46 26,48 

This puzzle protein does not have any ligands.

This puzzle protein has a single chain.

See players' solutions from previous visits to puzzle 55:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
55: Scorpion Toxin 05/23/08 9,032 Diderot 9,032 Another Hour Another Point
1041: Revisiting Puzzle 55: Scorpion Toxin 01/29/15 9,732 gitwut 9,737 Bletchley Park 9,737 Contenders
1244: Revisiting Puzzle 55: Scorpion Toxin 06/08/16 9,880 Skippysk8s 9,908 Skippysk8s 9,908 Gargleblasters
1495: Revisiting Puzzle 55: Scorpion Toxin 03/19/18 10,706 LociOiling 10,703 smilingone 10,706 Beta Folders
1542b: Sketchbook Puzzle - Revisiting Puzzle 55: Scorpion Toxin 07/09/18 10,480 fiendish_ghoul 10,195 Bruno Kestemont 10,405 Void Crushers
1687: Revisiting Puzzle 55: Scorpion Toxin 06/24/19 10,633 NinjaGreg 10,643 toshiue 10,643 Go Science
1955: Revisiting Puzzle 55: Scorpion Toxin 02/18/21 10,625 ZeroLeak7 10,673 mirp 10,673 Go Science
Advertisement