52: Bacteria Energy is a revisiting puzzle, originally presented in 2009 as Puzzle 52: Bacteria Energy.
As the name suggests, this protein an enzyme from bacteria, specifically the ever-popular E. coli. The protein is a phosphotransferase, part of the system that transports sugars into the cell.
The puzzle has 103 segments with the sequence:
kkhiylfssagmstsllvskmraqaekyevpviieafpetlagekgqnadvvllgpqiaymlpeiqrllpnkpvevidsllygkvdglgvlkaavaaikkaaa
Protein Data Bank matches for this sequence:
This puzzle does not have any disulfide bridges.
This puzzle does not have any ligands.
This puzzle has a single chain.
Tip: The starting structure for this puzzle has a misaligned N-terminal beta sheet. You will need to move the sheet "up" to have it meet the three other sheets. Using cutpoints and the ideal SS may help, although you may want to trim a few residues off the second sheet (counting from N-terminal) first to keep things from becoming too "stiff".
See players' solutions from previous visits to this puzzle:
puzzle | closed | top solo score | top solo | top evo score | top evo | top group score | top group | comments |
---|---|---|---|---|---|---|---|---|
52: Bacteria Energy | 05/16/08 | 10,296 | rafkin | 10,296 | Richard Dawkins Foundation | |||
700: Revisiting Puzzle 52 (Bacteria Energy) | 04/23/13 | 10,583 | pauldunn | 10,641 | ErichVonSterich | 10,641 | Anthropic Dreams | |
1034: Revisiting Puzzle 52: Bacteria Energy | 11/15/15 | 9,258 | LociOiling | 9,256 | LociOiling | 9,258 | Beta Folders | |
1238: Revisiting Puzzle 52: Bacteria Energy | 06/01/16 | 9,850 | LociOiling | 9,855 | smilingone | 9,855 | Beta Folders | |
1489: Revisiting Puzzle 52: Bacteria Energy | 03/07/18 | 9,861 | ZeroLeak7 | 9,864 | Bruno Kestemont | 9,846 | Go Science | |
1682: Revisiting Puzzle 52: Bacterial Energy | 06/10/19 | 11,512 | Bruno Kestemont | 11,527 | Bruno Kestemont | 11,527 | Go Science | |
1946: Revisiting Puzzle 52: Bacteria Energy | 01/28/21 | 11,575 | LociOiling | 11,567 | LociOiling | 11,575 | Beta Folders | |
2215: Revisiting Puzzle 52: Bacteria Energy | 10/27/22 | 11,648 | LociOiling | 11,646 | Galaxie | 11,648 | Anthropic Dreams |