Foldit Wiki
Advertisement

spmm's rat TCR protein from puzzle 1030.

Rosetta Decoy 14 is a revisiting puzzle, originally presented as Puzzle 157: Rosetta Decoy 14 in 2009.

This puzzle was the fourteenth in a series of 15 Rosetta decoys, which invited Foldit players to correct decoys produced through Rosetta, including the Rosetta@Home program.

The puzzle protein has been solved. It's part of the immune system of Rattus norvegicus, also known as the brown rat. The protein is described as being part of the "T-cell receptor V Beta domain". A T-cell receptor or TCR is found on the surface of a T-cell, and allows the T-cell to recognize antigens.

A T-cell receptor is made of two different protein chains. Each chain is identified by a Greek letter. The puzzle protein is from the Beta chain. The "V Beta" designation means this protein is from the variable part of the chain. There's also a "C" or constant section.

Unlike most proteins seen in Foldit, this one is extracellular, found of the outer surface of a T-cell. The varible part of a TCR chain is actually the furthest from the T-cell, while the constant part anchors the chain to the T-cell.

The puzzle protein has 110 segments with the sequence:

eaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagntekgdipdgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

This sequence is found in these Protein Data Bank entries:

  • 2APB (chain A, offset 0)

PDB entry 2APB above matches all 110 segments of the puzzle protein exactly. There are several additional PDB entries that match 109 out of 110 segments. Some of these entries have a different amino acid at segment 54, asparagine, replacing it with serine. Others replace the alanine at segment 52 with valine.

The puzzle protein can have one disulfide bridge, identified in 2APB as 23-92. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed.

The PDB model for 2APB for some reason skips residue number 64. As a result, residue 65 corresponds to Foldit segment 64. This offset continues to the end of the protein, so the cysteine identified as residue 92 is actually segment 91 in the Foldit puzzle.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridge in this format:

23,91

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
157: Rosetta Decoy 14 06/23/09 10,608 Steven Pletsch 10,556 Madde 10,608 Another Hour Another Point
1030: Revisiting Puzzle 157: Rosetta Decoy 14 12/31/14 9,597 spmm 9,629 jamiexq 9,629 Anthropic Dreams
1232: Revisiting Puzzle 157: Rosetta Decoy 14 05/18/16 10,125 LociOiling 10,171 reefyrob 10,171 Beta Folders
1483: Revisiting Puzzle 157: Rosetta Decoy 14 02/21/18 10,102 LociOiling 10,115 smilingone 10,115 Beta Folders
1940: Revisiting Puzzle 157: Rosetta Decoy 14 01/14/21 11,698 grogar7 11,702 Galaxie 11,702 Anthropic Dreams
Advertisement