Foldit Wiki
Advertisement

BitSpawn's thioredoxin from puzzle 1019.

150: Rosetta Decoy 12 is a revisiting puzzle, originally presented as Puzzle 150: Rosetta Decoy 12 in 2009.

This puzzle was the twelveth in a series of 15 Rosetta decoys, which invited Foldit players to correct decoys produced through Rosetta, including the Rosetta@Home program.

The puzzle protein has been solved, and is identified as mutant form of human thioredoxin. The solved protein has the characteristic thioredoxin fold.

The puzzle protein has 105 segments with the sequence:

mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvndcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

This sequence is found in this Protein Data Bank entry:

  • 1AIU (chain A, offset 0)

The puzzle protein does not form disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
150: Rosetta Decoy 12 05/29/09 10,592 LennStar 10,594 Madde 10,594 Void Crushers missing #2 group
1023: Revisiting Puzzle 150: Rosetta Decoy 12 12/17/14 9,599 BitSpawn 9,600 jermainiac 9,600 Anthropic Dreams
1225: Revisiting Puzzle 150: Rosetta Decoy 12 05/04/16 9,965 LociOiling 9,964 smilingone 9,965 Beta Folders
1477: Revisiting Puzzle 150: Rosetta Decoy 12 02/07/18 9,947 LociOiling 9,960 smilingone 9,960 Beta Folders
1934: Revisiting Puzzle 150: Rosetta Decoy 12 02/07/18 11,635 ZeroLeak7 11,640 mirp 11,640 Go Science
Advertisement