BitSpawn's P. aerophilum protein from puzzle 1013.

144: Rosetta Decoy 8 is a revisiting puzzle, originally presented as Puzzle 144: Rosetta Decoy 8 in 2009.

This puzzle was the eighth in a series of 15 Rosetta decoys, which invited Foldit players to correct decoys produced through Rosetta, including the Rosetta@Home program.

The puzzle protein has been solved. It's a "hypothetical protein", identified from the DNA of Pyrobaculum aerophilum, one of the archaea, single-celled organisms which were once lumped in with bacteria, but are now classified as a separate domain. As the "pyro" in its name hints,Pyrobaculum aerophilum likes it hot, growing best at around the boiling point of water.

The function of this particular protein is unknown.

The puzzle protein has 101 segments with the sequence:

mkkhiiiktipkkeeiisrdlcdciyyydnsvickpigpskvyvstslenlekclqlhyfkklvknieifdevhnskpncdkcliveiggvyfvrrvngvp

This sequence is found in these Protein Data Bank entries:

  • 1RKI (chains A, B; offset 0)

The puzzle protein can have three disulfide bridges, identified in 1RKI a a 22-34, 24-54, and 80-83. Recent revisits to this puzzle have awarded a bonus of 250 for each bridge formed.

The recipe Bridge Wiggle v 1.2.1 - Brow42 accepts the bridge in this format:

22,34 24,54 80,83 

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits to this puzzle:

Complete series of revisits with top scores:

puzzle closed top solo score top solo top evo score top evo top group score top group comments
144: Rosetta Decoy 8 05/15/09 10,420 Steven Pletsch 10,435 nelsongene 10,435 Richard Dawkins Foundation
1013: Revisiting Puzzle 144: Rosetta Decoy 8 11/19/14 10,206 BitSpawn 10,213 Galaxie 10,213 Anthropic Dreams
1213: Revisiting Puzzle 144: Rosetta Decoy 8 04/06/16 10,473 Bruno Kestemont 10,475 pauldunn 10,475 Go Science
1465: Revisiting Puzzle 144: Rosetta Decoy 8 01/10/18 10,913 Maerlyn138 10,536 eromana 10,913 Go Science scoring glitch?
1922: Revisiting Puzzle 144: Rosetta Decoy 8 12/03/20 12,045 dcrwheeler 12,022 NinjaGreg 12,029 Go Science
Community content is available under CC-BY-SA unless otherwise noted.